⚠️
This domain has been flagged as malicious
Detected by 9 security vendors and listed in 1 public blocklist. Exercise extreme caution — do not enter personal information or connect wallets.
telstracommunicationvalidationsystem.framer.website favicon

telstracommunicationvalidationsystem[.]framer[.]website

Domain Security & Threat Intelligence Report

“Sign in with your Telstra ID”

9/9 VT URLQuery: 100 Taken Down Oct 17, 2025 1 Blocklist Telstra Credential Phishing 1 Report Sent 132d takedown US US + more
9/9 VT vendors 1 blocklist Targets Telstra
100 Risk Score
PhishDestroy AI
HIGH
Ref
8D846794
Score
100/100
Engine
PD-4 Turbo
PhishDestroy identifies telstracommunicationvalidationsystem[.]framer[.]website as a medium-risk brand impersonation phishing domain targeting Telstra customers. It presented a fake login page titled "Sign in with your Telstra ID" to trick users into submitting their credentials, aiming to harvest sensitive information under the guise of legitimate Telstra communication validation.

Technically, the domain was registered on 2021-11-19 through CSC Corporate Domains Inc. It resolved to IP address 52.223.52.2 and appeared on one security blocklist. VirusTotal flagged it by 9 out of 95 security vendors, indicating moderate detection by threat intelligence systems. The site leveraged the framer.website hosting platform to facilitate its phishing operation.

Currently, the domain is offline, preventing further credential theft. Despite this, users are advised to remain vigilant against similar Telstra impersonation schemes and verify URLs carefully before entering login information. Organizations should continue monitoring brand-related phishing variants and update blocklists to mitigate risks. Reporting suspicious Telstra-themed phishing attempts to official support channels is also recommended.
VT
VirusTotal
9 det.
UQ
URLQuery
100 det.
CF Radar
Malicious
US
URLScan
Age
4.4 yr
Status
Down 404
PD
DestroyList
Listed
Reports Sent
1
Data coverage VirusTotal 9 / 9 URLQuery 100 det. OTX no pulses CF Radar malicious URLScan report ready DNS blocks none SSL no cert WHOIS 54 mo old Screenshot not captured Redirect chain not probed CDN bypass not suspended
Network Security Intelligence
CF Cloudflare Radar Verdict Malicious
Phishing Phishing Security threats

Threat Response Pipeline

Discovery
Submission
Legal
Takedown
28/28
Pre-emptive Discovery & Ingestion
30+ Proprietary Parsers · Infrastructure Analysis · Community Intelligence · Threat Ingested
4/4 ✓
30+ Proprietary Parsers
Distributed network scanning Google Ads (malvertising), SEO-manipulated results, Twitter/X, YouTube & Telegram campaigns
Infrastructure Analysis
dnstwist & typosquatting detection to catch look-alike domains targeting established brands
Community Intelligence
Real-time ingestion of community-reported threats via Telegram Bot & partner intelligence feeds
Threat Ingested
telstracommunicationvalidationsystem.framer.website detected and queued for full analysis
Oct 17, 2025
Global Ecosystem Submission
54+ Vendor Submissions · URLScan.io Snapshot · Cloudflare Radar · Web Archive · VirusTotal · Google Safe Browsing · Blocklist Detection · CF Radar: Malicious · Brand Impersonation · Forensic Evidence Collection · Web Archive Preservation · Technical Deep Analysis · Cloudflare Radar Scan · Cloudflare Radar Scan · Site Went Offline · Cloudflare Radar Scan
16/16 ✓
54+ Vendor Submissions
Threat data submitted to 54+ security vendors & threat intelligence platforms
Show all 54 vendors
SpamhausCloudflareGoogle Safe BrowsingMicrosoft SecurityVirusTotalNetcraftESETBitdefenderNorton Safe WebAviraPhishTankDr.WebYandex Safe BrowsingURLScan.ioPolySwarmSiteReviewURLQueryPhishStatsPhishReportIsItPhishThreatCenterKasperskyOpenPhishAPWG eCrimeComodo / XcitiumFortinet / FortiGuardPalo Alto NetworksSophosTrend MicroWebrootZeroFOXSURBLAbusixCRDF LabsQuad9CleanBrowsingCyRadarScumware.orgPhishing.DatabaseMalware PatrolANY.RUNHybrid AnalysisURLhausMalwareBazaarThreatFoxAbuse.chAbuseIPDBAlienVault OTXMISPDomainToolsSecurityTrailsCensysBinaryEdgeCIRCL
URLScan.io Snapshot
Submitted to urlscan.io — screenshot, DOM & HTTP transactions captured
Mar 04, 2026
Cloudflare Radar
Scanned via Cloudflare Radar — DNS, certificates & network data
Web Archive
Preserved in Wayback Machine — historical evidence archived
VirusTotal
9 / 9 vendors flagged on VirusTotal
Feb 23, 2026
Google Safe Browsing
Mar 03, 2026
Blocklist Detection
Found in 1 blocklist: PhishDestroy
Mar 24, 2026
CF Radar: Malicious
Cloudflare Radar classified this domain as phishing, Phishing, Security threats
Brand Impersonation
Impersonation of Telstra
Forensic Evidence Collection
Public scans via URLScan.io, URLQuery & Cloudflare Radar — DOM snapshots, HTTP transactions, DNS & certificate data
Web Archive Preservation
Site preserved in Wayback Machine — immutable copy of phishing content for legal evidence
Technical Deep Analysis
JS source analysis, directory enumeration, open directories scan, email harvesting, Telegram bot detection, exposed databases & other OSINT artifacts useful for threat actor identification
Cloudflare Radar Scan
Scanned via Cloudflare Radar — network analysis completed
Mar 07, 2026
Cloudflare Radar Scan
Scanned via Cloudflare Radar — network analysis completed
Mar 07, 2026
Site Went Offline
Domain stopped responding (HTTP 404) — taken down
Feb 27, 2026
Cloudflare Radar Scan
Scanned via Cloudflare Radar — network analysis completed
Feb 27, 2026
Legal Notifications & Reporting
Registrar & Hosting Notification · DestroyList Published · Abuse Reports Sent · Conditional Re-detection
4/4 ✓
Registrar & Hosting Notification
Initial abuse reports sent to domain registrar (CSC Corporate Domains, Inc.) and hosting provider with forensic evidence packages (metadata, screenshots, PDF)
DestroyList Published
Added to PhishDestroy/DestroyList — open-source blocklist for wallets & extensions
Oct 17, 2025
Abuse Reports Sent
Abuse report sent to registrar CSC Corporate Domains, Inc., hosting provider, 1 abuse contact
Oct 17, 2025
Conditional Re-detection
Follow-up alerts only if threat remains active beyond 24 hours — prevents spam, ensures reports contain active evidence
ICANN Escalation — triggered only on re-detection (24h+ active threat), not on initial report. Formal complaint per RAA §3.18 with full forensic evidence
Public Transparency & Takedown
Open Threat Database · Social Broadcasting · Domain Taken Down · Response Time
4/4 ✓
Open Threat Database
Real-time commits to GitHub repository & live monitoring at phishdestroy.io/live
Social Broadcasting
Automated alerts on Twitter, Telegram & Mastodon channels
Domain Taken Down
Phishing site is offline — no longer serving malicious content
Feb 27, 2026
Response Time
Takedown in 3179 hours from detection

Public Blocklist Status

Evidence Capture

Live Snapshot
2025-10-17 18:27 UTC
Malicious · 9/9 engines
Forensic screenshot of telstracommunicationvalidationsystem.framer.website showing the phishing page layout
IP: 35.71.142.77
CSC Corporate Domains, Inc.
1,615d old
Page Title
Sign in with your Telstra ID

Domain Intelligence

Domaintelstracommunicationvalidationsystem.framer.website
IP Address 35.71.142.77 US
GeoUS Seattle, US
NetworkASAS16509 · AS16509 Amazon.com, Inc.
RegistrationCreated Nov 19, 2021 Expires Nov 19, 2026
HTTP Status404 Not Found
Takedown Time 132 days
What we count Elapsed time from the first abuse report we filed to the confirmed takedown of telstracommunicationvalidationsystem.framer.website.
What each report contains Every report delivered to CSC Corporate Domains, Inc. includes the full forensic bundle we have on file — VirusTotal verdict, URLScan snapshot, WHOIS, SSL metadata, IP & hosting chain, impersonated-brand evidence, drainer / kit classification if applicable, screenshots, and a cryptographic hash of the forensic PDF. The e-mail explicitly requests the registrar to review the client against their acceptable-use policy and take action under ICANN RAA §3.18.
HTTP Status404
Technical detailsDNS, SSL SANs, timestamps
First DetectedOct 17, 2025
Nameserversns-1243.awsdns-27.orgns-1818.awsdns-35.co.ukns-336.awsdns-42.comns-792.awsdns-35.net
TLS Fingerprintb3445573cc07ede57a843d22babf8e3b977a95a0…
Related Campaign Members · 8 sharing fingerprint
Other tracked phishing domains sharing this site’s infrastructure fingerprint: CSC Corporate Domains, Inc. Telstra — suggests a coordinated kit / operator cluster.
smtptelstrawebmailswifttviewtelstra.framer.website
Taken down 10 VT
swift-webmail-view.framer.website
Taken down 14 VT
telstraautomative.framer.website
Taken down 10 VT
telstrasystemreactivation.framer.website
Taken down 12 VT
teltrservvisupprttttssystt.framer.website
Taken down 12 VT
telstrawebmailautoau.framer.website
Taken down 12 VT
telstraupdatingmailbox.framer.website
Taken down 11 VT
telstrarecoverysystem.framer.website
Taken down 12 VT
View all active campaigns Filter hub by this fingerprint
Technologies · 4 identified
Framer Sites
React
JavaScript frameworks

JavaScript library for building user interfaces with component-based architecture.

HSTS
Security

HTTP Strict Transport Security — forces browsers to use HTTPS connections only.

HTTP/3
Miscellaneous

Third major version of HTTP protocol, built on QUIC for faster, more reliable connections.

Detected via Cloudflare Radar · Wappalyzer engine
Report This Domain Submit evidence & help protect others

VirusTotal Analysis

9 / 9 security vendors flagged this domain
View on VT
ADMINUSLabs
alphaMountain.ai
CyRadar
ESET
Forcepoint ThreatSeeker
Fortinet
Kaspersky
Sophos
Webroot

Archived Evidence

Wayback Machine Snapshot
This site was archived before takedown — evidence preserved
View Archive

Evidence & External Reports

Were You Affected by This Site?

You are not alone and there is nothing to be ashamed of. Scammers are sophisticated criminals who exploit trust. Reporting your experience is the most powerful weapon against fraud — your report can prevent others from becoming victims and help law enforcement take action. Silence is the scammer's greatest advantage. Break it.

If you have interacted with this domain, entered personal information, or connected a cryptocurrency wallet — take immediate action. Below are resources to help you report the incident and protect yourself.

Beware of recovery scammers! After being scammed, criminals may contact you again pretending to be "recovery agents," lawyers, or investigators who claim they can retrieve your lost funds — for a fee. This is a second scam. No legitimate service will ask for upfront payment to recover stolen crypto. Learn more about recovery fraud →

Report to Your Local Authorities

Select your country to get official cybercrime contacts, or generate an AI-powered complaint →

Select your country...
180+ countries
Zero-PII — your data never leaves the browser AI writes in your language

Related Domain Reports

dsjhfjdjh-hkdfjg-4a4589.netlify.app
dsjhfjdjh-hkdfjg-4a4589.netlify.app
21 detections · Similar title
tpbpcommunitels234.framer.website
tpbpcommunitels234.framer.website
20 detections · Similar title
saintdashboard.com
saintdashboard.com
20 detections · Similar title
fearless-calendar-501570.framer.app
fearless-calendar-501570.framer.app
19 detections · Similar title
scriptblox.cc
scriptblox.cc
5 detections
airdropsalert.onl
airdropsalert.onl
15 detections
bybitvar.com
bybitvar.com
18 detections
rewards-pengu.xyz
rewards-pengu.xyz
12 detections

Other Domains on 35.71.142.77 6 phishing domains

This IP hosts multiple phishing domains — infrastructure shared across campaigns

creative-backgrounds-489117.framer.app favicon creative-backgrounds-489117.framer.app 24/95 determined-employee-705783.framer.app favicon determined-employee-705783.framer.app 23/95 centered-video-625311.framer.app favicon centered-video-625311.framer.app 22/95 tactical-run-563801.framer.app favicon tactical-run-563801.framer.app 22/95 happier-core-546146.framer.app favicon happier-core-546146.framer.app 22/95 more-report-557996.framer.app favicon more-report-557996.framer.app 22/95

More Domains at CSC 6 flagged

bafkreibawwibszeisgf7jarjpm3p2qeze6nejxl3p2hbioadratcofntgm.ipfs.dweb.link favicon bafkreibawwibszeisgf7jarjpm3p2qeze6nejxl3p2hbioadratcofntgm.ipfs.dweb.link 13/95 bafybeifhkli7dfi6brfwr3637krztfkps6yf26wqe45ks7mq23jkrg5pzm.ipfs.dweb.link favicon bafybeifhkli7dfi6brfwr3637krztfkps6yf26wqe45ks7mq23jkrg5pzm.ipfs.dweb.link 23/95 sol.com favicon sol.com yumi.framer.ai favicon yumi.framer.ai 3/95 yumifinance.framer.ai favicon yumifinance.framer.ai 3/95 bafybeiclh4rdjgenba3udk2t6t7k6mg2xhf5z6vspwffh4vtbgqqrfwbwe.ipfs.dweb.link favicon bafybeiclh4rdjgenba3udk2t6t7k6mg2xhf5z6vspwffh4vtbgqqrfwbwe.ipfs.dweb.link 23/95

Other Telstra Impersonation Domains

These domains also target Telstra users. View all Telstra threats →

dsjhfjdjh-hkdfjg-4a4589.netlify.app dsjhfjdjh-hkdfjg-4a4589.netlify.app 21 tpbpcommunitels234.framer.website tpbpcommunitels234.framer.website 20 fanciful-mochi-5f3a5e.netlify.app fanciful-mochi-5f3a5e.netlify.app 19 fearless-calendar-501570.framer.app fearless-calendar-501570.framer.app 19 grounded-course-230298.framer.app grounded-course-230298.framer.app 19 myid-telstra.flutterflow.app myid-telstra.flutterflow.app 19 earlier-concept-180784.framer.app earlier-concept-180784.framer.app 18 fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com 18

About This Report: telstracommunicationvalidationsystem.framer.website

This domain security report for telstracommunicationvalidationsystem.framer.website is maintained by PhishDestroy's automated threat intelligence pipeline. Our system continuously monitors this domain across 9 security vendors on VirusTotal, 1 public blocklists, URLScan.io.

The site displays a page titled “Sign in with your Telstra ID”, which may be designed to impersonate Telstra.

telstracommunicationvalidationsystem.framer.website has been flagged by 9 security vendors as of April 22, 2026.

If you believe this listing is inaccurate, you can submit an appeal. For more information about our methodology, visit our FAQ page.

Check Any Domain

Instant threat analysis with 50+ security engines, AI classification & forensic evidence

Scan Now

Report Phishing

Submit suspicious domains to our threat database — protect the community

Report

Live Threat Feed

Real-time monitoring of active phishing campaigns & takedown progress

Monitor

Stay Informed, Stay Safe

Monitor live threats or contest this listing if you believe it's a false positive

Live Threat Feed Appeal This Listing

Recommendations & Advice for Victims

An estimated $51 billion flowed to illicit crypto wallets in 2024 (source). If you interacted with telstracommunicationvalidationsystem.framer.website — act now.

What should I do immediately?
Urgent
  • Revoke token approvals — use revoke.cash to remove access granted to malicious smart contracts
  • Move remaining funds to a brand-new wallet. The compromised wallet is no longer safe
  • Change all passwords — email, exchange accounts, anything that shares the same password
  • Enable 2FA using an authenticator app (not SMS). Disable SMS-based recovery
  • Freeze cards if you entered banking details on the phishing site
What information should I collect for my report?
FBI guidelines

According to the FBI, the most important details are transaction data:

  • Cryptocurrency addresses — scammer's wallet (e.g., 0x5856...35985)
  • Amount & crypto type — exact amount (e.g., 1.02345 ETH, 0.5 BTC, 500 USDT)
  • Transaction ID (hash) — the unique blockchain transaction identifier
  • Exact dates & times — of each transaction and first contact with scammer
  • Screenshots — scam website, chat messages, emails, wallet transactions, social media
  • All URLs & domains used by the scammer (including telstracommunicationvalidationsystem.framer.website)
  • Communications — emails, texts, phone numbers, usernames the scammer used

Even if you don't have all details — file a report anyway. Partial information still helps investigations.

Where should I report the scam?
  • FBI IC3 — Internet Crime Complaint Center (US federal reporting)
  • Europol — European cybercrime reporting (EU)
  • Chainabuse — flag scam wallets across exchanges & platforms
  • Your crypto exchange — contact Coinbase/Binance/Kraken support to freeze scammer's address
  • Local police — creates an official record, even if they can't act immediately

The FBI recovered over $1 billion in crypto fraud in 2024 thanks to victim reports. Your report matters.

How do crypto scams typically work?
  • Fake websites — pixel-perfect clones of legitimate sites with slightly altered domains
  • Malicious approvals — "connect wallet" prompts that grant unlimited token spending to attackers
  • Pig butchering — trust built over weeks via Telegram/WhatsApp/dating apps, then money stolen
  • Recovery scams — victims targeted AGAIN by fake "recovery agents" demanding upfront fees. Always a scam
  • Fake ads & airdrops — Google/social media ads and "free token" offers leading to wallet drainers
  • AI-powered scams — deepfakes, automated phishing, and AI-generated sites making fraud harder to detect
How can I protect myself in the future?
  • Use a hardware wallet (Ledger, Trezor). Never store large amounts in browser wallets
  • Bookmark official sites — never click links from emails, DMs, or ads
  • Read every approval — verify permissions before signing. Reject unlimited approvals
  • Verify domains — check on PhishDestroy before interacting. Check HTTPS, spelling, domain age
  • "Too good to be true" = scam — guaranteed returns, celebrity endorsements, urgent deadlines
How big is the crypto scam problem?
  • $51 billion flowed to illicit crypto wallets in 2024 — CoinLedger
  • Pig butchering losses grew 40% year over year, now the fastest-growing fraud type
  • Only ~5% of victims report — your report helps shut down criminal networks
  • FBI recovered $1B+ in 2024 thanks to victim reports — FBI.gov

Sources: FBI · CoinLedger · WorldMetrics

Embed This Report

Share this threat intelligence on your website or blog