⚠️
This domain has been flagged as malicious
Detected by 22 security vendors and listed in 1 public blocklist. Exercise extreme caution — do not enter personal information or connect wallets.
wassss92passsso.weebly.com favicon

wassss92passsso[.]weebly[.]com

Domain Security & Threat Intelligence Report

“Telstra”

22/95 VT Taken Down May 14, 2026 1 Blocklist Telstra Phishing Login 7h takedown US US + more
22/95 VT vendors 1 blocklist Targets Telstra
78 Risk Score
PhishDestroy AI
HIGH
Ref
B8D0324A
Score
78/100
Engine
PD-4 Turbo
PhishDestroy identifies wassss92passsso[.]weebly[.]com as an active crypto drainer phishing domain designed to trick users into surrendering cryptocurrency credentials or approving malicious token transfers. The site mimics legitimate crypto platforms to drain digital assets from victim wallets. Users who interact risk losing funds stored in connected wallets or private keys exposed through deceptive authorization flows. This domain was flagged by 22 out of 95 VirusTotal security vendors, indicating high threat potential. It was registered through MarkMonitor, Inc. on March 29, 2006, and currently resolves to IP 74.115.51.9. It is blocked by two major threat intelligence feeds: OpenPhish and OISD. Additionally, it holds a Let's Encrypt SSL certificate, which may give it a false sense of legitimacy. If you visited this domain or entered any information, disconnect your wallet immediately and revoke any unauthorized token approvals using tools like Etherscan or Revoke.cash. Do not interact further with this domain. Report it to your cybersecurity team or through platforms like Google Safe Browsing to help prevent wider exposure. Always verify crypto sites via official channels before entering credentials or approving transactions.
VirusTotal
VirusTotal
22 det.
CF Radar
Malicious
URLScan
URLScan
Gridinsoft
0/100
SA
Scamadviser
1/100
SSL
Let's Encrypt
Age
20.3 yr
Status
Down
PhishDestroy
DestroyList
Listed
Data coverage VirusTotal 22 / 95 URLQuery no detections OTX no pulses CF Radar malicious URLScan report ready DNS blocks none SSL valid, 58d WHOIS 247 mo old Screenshot not captured Redirect chain not probed Live ping not reachable CDN bypass not suspended Gridinsoft 0/100 Scamadviser 1/100
Network Security Intelligence
CF Cloudflare Radar Verdict Malicious
Phishing Phishing Security threats

Threat Response Pipeline

Discovery
Submission
Legal
Takedown
22/22
Pre-emptive Discovery & Ingestion
30+ Proprietary Parsers · Infrastructure Analysis · Community Intelligence · Threat Ingested
4/4 ✓
30+ Proprietary Parsers
Distributed network scanning Google Ads (malvertising), SEO-manipulated results, Twitter/X, YouTube & Telegram campaigns
Infrastructure Analysis
dnstwist & typosquatting detection to catch look-alike domains targeting established brands
Community Intelligence
Real-time ingestion of community-reported threats via Telegram Bot & partner intelligence feeds
Threat Ingested
wassss92passsso.weebly.com detected and queued for full analysis
May 14, 2026
Global Ecosystem Submission
54+ Vendor Submissions · Cloudflare Radar · VirusTotal · Google Safe Browsing · Blocklist Detection · CF Radar: Malicious · Brand Impersonation · Forensic Evidence Collection · Web Archive Preservation · Technical Deep Analysis
10/10 ✓
54+ Vendor Submissions
Threat data submitted to 54+ security vendors & threat intelligence platforms
Show all 54 vendors
SpamhausCloudflareGoogle Safe BrowsingMicrosoft SecurityVirusTotalNetcraftESETBitdefenderNorton Safe WebAviraPhishTankDr.WebYandex Safe BrowsingURLScan.ioPolySwarmSiteReviewURLQueryPhishStatsPhishReportIsItPhishThreatCenterKasperskyOpenPhishAPWG eCrimeComodo / XcitiumFortinet / FortiGuardPalo Alto NetworksSophosTrend MicroWebrootZeroFOXSURBLAbusixCRDF LabsQuad9CleanBrowsingCyRadarScumware.orgPhishing.DatabaseMalware PatrolANY.RUNHybrid AnalysisURLhausMalwareBazaarThreatFoxAbuse.chAbuseIPDBAlienVault OTXMISPDomainToolsSecurityTrailsCensysBinaryEdgeCIRCL
Cloudflare Radar
Scanned via Cloudflare Radar — DNS, certificates & network data
VirusTotal
22 / 95 vendors flagged on VirusTotal
May 14, 2026
Google Safe Browsing
May 14, 2026
Blocklist Detection
Found in 1 blocklist: PhishDestroy
Jun 27, 2026
CF Radar: Malicious
Cloudflare Radar classified this domain as Phishing, phishing, Security threats
Brand Impersonation
Impersonation of Telstra
Forensic Evidence Collection
Public scans via URLScan.io, URLQuery & Cloudflare Radar — DOM snapshots, HTTP transactions, DNS & certificate data
Web Archive Preservation
Site preserved in Wayback Machine — immutable copy of phishing content for legal evidence
Technical Deep Analysis
JS source analysis, directory enumeration, open directories scan, email harvesting, Telegram bot detection, exposed databases & other OSINT artifacts useful for threat actor identification
Legal Notifications & Reporting
Registrar & Hosting Notification · DestroyList Published · Abuse Reports Sent · Conditional Re-detection
4/4 ✓
Registrar & Hosting Notification
Initial abuse reports sent to domain registrar (MarkMonitor, Inc.) and hosting provider with forensic evidence packages (metadata, screenshots, PDF)
DestroyList Published
Added to PhishDestroy/DestroyList — open-source blocklist for wallets & extensions
May 14, 2026
Abuse Reports Sent
Abuse report sent to registrar MarkMonitor, Inc., hosting provider, 3 abuse contacts
May 14, 2026
Conditional Re-detection
Follow-up alerts only if threat remains active beyond 24 hours — prevents spam, ensures reports contain active evidence
ICANN Escalation — triggered only on re-detection (24h+ active threat), not on initial report. Formal complaint per RAA §3.18 with full forensic evidence
Public Transparency & Takedown
Open Threat Database · Social Broadcasting · Domain Taken Down · Response Time
4/4 ✓
Open Threat Database
Real-time commits to GitHub repository & live monitoring at phishdestroy.io/live
Social Broadcasting
Automated alerts on Twitter, Telegram & Mastodon channels
Domain Taken Down
Phishing site is offline — no longer serving malicious content
May 15, 2026
Response Time
Takedown in 7 hours from detection

Public Blocklist Status

Evidence Capture

Live Snapshot
2026-05-14 18:31 UTC
Malicious · 22/95 engines
Forensic screenshot of wassss92passsso.weebly.com showing the phishing page layout
IP: 74.115.51.9
MarkMonitor, Inc.
7,395d old
Let's Encrypt
Page Title
Telstra

Domain Intelligence

Domainwassss92passsso.weebly.com
IP Address 74.115.51.9 US
GeoUS Oakland, US
NetworkAS27647 · Weebly, Inc.
RegistrationCreated Mar 29, 2006
Takedown Time 7h
What we count Elapsed time from the first abuse report we filed to the confirmed takedown of wassss92passsso.weebly.com.
What each report contains Every report delivered to MarkMonitor, Inc. includes the full forensic bundle we have on file — VirusTotal verdict, URLScan snapshot, WHOIS, SSL metadata, IP & hosting chain, impersonated-brand evidence, drainer / kit classification if applicable, screenshots, and a cryptographic hash of the forensic PDF. The e-mail explicitly requests the registrar to review the client against their acceptable-use policy and take action under ICANN RAA §3.18.
Technical detailsDNS, SSL SANs, timestamps
First DetectedMay 14, 2026
Nameserversns-123.awsdns-15.comns-1500.awsdns-59.orgns-1797.awsdns-32.co.ukns-646.awsdns-16.net
TLS Fingerprint5030d04ba7102135fff71e4de7c4b13a750ef5e1…
Favicon Hashfavicon4d27526198ac873ccec96935198e0fb9
Technologies · 8 identified
Weebly
CMS

Weebly is a website and ecommerce service.

www.weebly.com 100% confidence
MySQL
Databases

MySQL is an open-source relational database management system.

mysql.com 100% confidence
PHP
Programming languages

PHP is a general-purpose scripting language used for web development.

php.net 100% confidence
Amazon Web Services
PaaS

Amazon Web Services (AWS) is a comprehensive cloud services platform offering compute power, database storage, content delivery and other functionality.

aws.amazon.com 100% confidence
reCAPTCHA
Security

reCAPTCHA is a free service from Google that helps protect websites from spam and abuse.

www.google.com 100% confidence
jQuery
JavaScript libraries

jQuery is a JavaScript library which is a free, open-source software designed to simplify HTML DOM tree traversal and manipulation, as well as event handling, CSS animation, and Ajax.

jquery.com 100% confidence
Google Analytics
Analytics

Google Analytics is a free web analytics service that tracks and reports website traffic.

google.com 100% confidence
Cloudflare
CDN

Cloudflare is a web-infrastructure and website-security company, providing content-delivery-network services, DDoS mitigation, Internet security, and distributed domain-name-server services.

www.cloudflare.com 100% confidence
Detected via Cloudflare Radar · Wappalyzer engine
Report This Domain Submit evidence & help protect others

VirusTotal Analysis

22 / 95 security vendors flagged this domain
View on VT
ADMINUSLabs
alphaMountain.ai
BitDefender
Chong Lua Dao
CyRadar
Ermes
ESET
Emsisoft
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
Kaspersky
LevelBlue
Lionic
MalwareURL
Netcraft
OpenPhish
Seclookup
Sophos
Site Performance Analysis

Google PageSpeed Insights — mobile performance audit of wassss92passsso.weebly.com · checked May 14, 2026

69
Needs Work
Performance
FCP
3.53s
First Contentful Paint
LCP
3.7s
Largest Contentful Paint
CLS
0.02
Cumulative Layout Shift
TBT
501ms
Total Blocking Time
SI
3.53s
Speed Index
Powered by Google PageSpeed Insights · Mobile strategy · Scores: 90-100 Good 50-89 Needs Work 0-49 Poor

Evidence & External Reports

Were You Affected by This Site?

You are not alone and there is nothing to be ashamed of. Scammers are sophisticated criminals who exploit trust. Reporting your experience is the most powerful weapon against fraud — your report can prevent others from becoming victims and help law enforcement take action. Silence is the scammer's greatest advantage. Break it.

If you have interacted with this domain, entered personal information, or connected a cryptocurrency wallet — take immediate action. Below are resources to help you report the incident and protect yourself.

Beware of recovery scammers! After being scammed, criminals may contact you again pretending to be "recovery agents," lawyers, or investigators who claim they can retrieve your lost funds — for a fee. This is a second scam. No legitimate service will ask for upfront payment to recover stolen crypto. Learn more about recovery fraud →

Report to Your Local Authorities

Select your country to get official cybercrime contacts, or generate an AI-powered complaint →

Select your country...
180+ countries
Zero-PII — your data never leaves the browser AI writes in your language

Related Domain Reports

att-105764.weeblysite.com
att-105764.weeblysite.com
23 detections · Same kit
bt-105274.weeblysite.com
bt-105274.weeblysite.com
23 detections · Same kit
connectt-xfinitys-auth.weebly.com
connectt-xfinitys-auth.weebly.com
22 detections · Same kit
mailattonline-00817450.weeblysite.com
mailattonline-00817450.weeblysite.com
22 detections · Same kit
mycsgoo.shop
mycsgoo.shop
8 detections
luzewin.com
luzewin.com
11 detections
photo-26654.cfd
photo-26654.cfd
19 detections
polymarktet.com
polymarktet.com
15 detections

Other Domains on 74.115.51.9 6 phishing domains

This IP hosts multiple phishing domains — infrastructure shared across campaigns

connectt-xfinitys-auth.weebly.com favicon connectt-xfinitys-auth.weebly.com 22/95 xfinityservicehtmls.weebly.com favicon xfinityservicehtmls.weebly.com 22/95 connect-xfinitys-com-appsuite.weebly.com favicon connect-xfinitys-com-appsuite.weebly.com 22/95 leddger-en-live.weebly.com favicon leddger-en-live.weebly.com 21/95 telstraaserviceadmin.weebly.com favicon telstraaserviceadmin.weebly.com 21/95 cconnects-xfinity.weebly.com favicon cconnects-xfinity.weebly.com 21/95

More Domains at MarkMonitor 6 flagged

auth--apps-kucooin-sso---cdnn.webflow.io favicon auth--apps-kucooin-sso---cdnn.webflow.io 11/95 metamasklogino.webflow.io favicon metamasklogino.webflow.io 10/95 trescerwallet.webflow.io favicon trescerwallet.webflow.io 14/95 start-troiezor.webflow.io favicon start-troiezor.webflow.io 8/95 terzer-iostarrt.webflow.io favicon terzer-iostarrt.webflow.io 15/95 xn--suite-trz-3xb.webflow.io favicon xn--suite-trz-3xb.webflow.io 15/95

Other Telstra Impersonation Domains

These domains also target Telstra users. View all Telstra threats →

dsjhfjdjh-hkdfjg-4a4589.netlify.app dsjhfjdjh-hkdfjg-4a4589.netlify.app 21 tpbpcommunitels234.framer.website tpbpcommunitels234.framer.website 20 fanciful-mochi-5f3a5e.netlify.app fanciful-mochi-5f3a5e.netlify.app 19 fearless-calendar-501570.framer.app fearless-calendar-501570.framer.app 19 grounded-course-230298.framer.app grounded-course-230298.framer.app 19 myid-telstra.flutterflow.app myid-telstra.flutterflow.app 19 earlier-concept-180784.framer.app earlier-concept-180784.framer.app 18 fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com 18

About This Report: wassss92passsso.weebly.com

This domain security report for wassss92passsso.weebly.com is maintained by PhishDestroy's automated threat intelligence pipeline. Our system continuously monitors this domain across 95 security vendors on VirusTotal, 1 public blocklists.

The site displays a page titled “Telstra”, which may be designed to impersonate Telstra.

wassss92passsso.weebly.com has been flagged by 22 security vendors as of June 27, 2026.

If you believe this listing is inaccurate, you can submit an appeal. For more information about our methodology, visit our FAQ page.

Check Any Domain

Instant threat analysis with 50+ security engines, AI classification & forensic evidence

Scan Now

Report Phishing

Submit suspicious domains to our threat database — protect the community

Report

Live Threat Feed

Real-time monitoring of active phishing campaigns & takedown progress

Monitor

Stay Informed, Stay Safe

Monitor live threats or contest this listing if you believe it's a false positive

Live Threat Feed Appeal This Listing

Recommendations & Advice for Victims

An estimated $51 billion flowed to illicit crypto wallets in 2024 (source). If you interacted with wassss92passsso.weebly.com — act now.

What should I do immediately?
Urgent
  • Revoke token approvals — use revoke.cash to remove access granted to malicious smart contracts
  • Move remaining funds to a brand-new wallet. The compromised wallet is no longer safe
  • Change all passwords — email, exchange accounts, anything that shares the same password
  • Enable 2FA using an authenticator app (not SMS). Disable SMS-based recovery
  • Freeze cards if you entered banking details on the phishing site
What information should I collect for my report?
FBI guidelines

According to the FBI, the most important details are transaction data:

  • Cryptocurrency addresses — scammer's wallet (e.g., 0x5856...35985)
  • Amount & crypto type — exact amount (e.g., 1.02345 ETH, 0.5 BTC, 500 USDT)
  • Transaction ID (hash) — the unique blockchain transaction identifier
  • Exact dates & times — of each transaction and first contact with scammer
  • Screenshots — scam website, chat messages, emails, wallet transactions, social media
  • All URLs & domains used by the scammer (including wassss92passsso.weebly.com)
  • Communications — emails, texts, phone numbers, usernames the scammer used

Even if you don't have all details — file a report anyway. Partial information still helps investigations.

Where should I report the scam?
  • FBI IC3 — Internet Crime Complaint Center (US federal reporting)
  • Europol — European cybercrime reporting (EU)
  • Chainabuse — flag scam wallets across exchanges & platforms
  • Your crypto exchange — contact Coinbase/Binance/Kraken support to freeze scammer's address
  • Local police — creates an official record, even if they can't act immediately

The FBI recovered over $1 billion in crypto fraud in 2024 thanks to victim reports. Your report matters.

How do crypto scams typically work?
  • Fake websites — pixel-perfect clones of legitimate sites with slightly altered domains
  • Malicious approvals — "connect wallet" prompts that grant unlimited token spending to attackers
  • Pig butchering — trust built over weeks via Telegram/WhatsApp/dating apps, then money stolen
  • Recovery scams — victims targeted AGAIN by fake "recovery agents" demanding upfront fees. Always a scam
  • Fake ads & airdrops — Google/social media ads and "free token" offers leading to wallet drainers
  • AI-powered scams — deepfakes, automated phishing, and AI-generated sites making fraud harder to detect
How can I protect myself in the future?
  • Use a hardware wallet (Ledger, Trezor). Never store large amounts in browser wallets
  • Bookmark official sites — never click links from emails, DMs, or ads
  • Read every approval — verify permissions before signing. Reject unlimited approvals
  • Verify domains — check on PhishDestroy before interacting. Check HTTPS, spelling, domain age
  • "Too good to be true" = scam — guaranteed returns, celebrity endorsements, urgent deadlines
How big is the crypto scam problem?
  • $51 billion flowed to illicit crypto wallets in 2024 — CoinLedger
  • Pig butchering losses grew 40% year over year, now the fastest-growing fraud type
  • Only ~5% of victims report — your report helps shut down criminal networks
  • FBI recovered $1B+ in 2024 thanks to victim reports — FBI.gov

Sources: FBI · CoinLedger · WorldMetrics

Embed This Report

Share this threat intelligence on your website or blog