⚠️
This domain has been flagged as malicious
Detected by 7 security vendors. Exercise extreme caution — do not enter personal information or connect wallets. Generate an official AI-powered complaint letter to file with cybercrime authorities.
telstrawebpersonalservice.framer.website favicon

telstrawebpersonalservice[.]framer[.]website

Domain Security & Threat Intelligence Report

“Sign in with your Telstra ID”

7/95 VT URLQuery: 100 Content unavailable Oct 24, 2025 Unavailable since Feb 27, 2026 Telstra Credential Phishing 1 Report Sent 126d to unavailable US US + more
95 Risk Score
PhishDestroy AI
HIGH
Ref
CA85FB22
Score
95/100
Engine
PD-4 Turbo
This report details a domain, telstrawebpersonalservice[.]framer[.]website, which hosted a credential phishing page impersonating the brand Telstra. The page title, "Sign in with your Telstra ID," indicates the site was designed to deceive users into entering their Telstra account credentials. The primary threat posed by this site is the theft of login credentials, which could lead to unauthorized account access.

Technical analysis reveals that the domain was flagged by 7 out of 95 VirusTotal vendors, including alphaMountain.ai, Forcepoint ThreatSeeker, Fortinet, Kaspersky, and Phishing Database. It is listed on 2 blocklists. The domain is registered with CSC Corporate Domains, Inc., and was created on 2021-11-19. It resolves to IP address 35.71.142.77, located in the United States and hosted on AS16509 (Amazon.com, Inc.). The site uses a Let's Encrypt SSL certificate (E7) and has nameservers ns-1243.awsdns-27.org, ns-1818.awsdns-35.co.uk, ns-336.awsdns-42.com, and ns-792.awsdns.

The domain is currently offline, reducing immediate risk of credential theft. However, given its history of phishing detections and brand impersonation, the risk level is assessed as high for any users who may have previously visited the site and entered credentials. Users should change their Telstra account passwords if they interacted with this site.
VirusTotal
VirusTotal
7 det.
URLQuery
URLQuery
100 det.
CF Radar
Malicious
URLScan
URLScan
Age
4.7 yr
Observed status
Content unavailable 404
PhishDestroy
DestroyList
Listed
Reports Sent
1
Data coverage VirusTotal 7 / 95 URLQuery 100 det. OTX no pulses CF Radar malicious URLScan report ready DNS blocks none SSL no cert WHOIS 57 mo old Screenshot not captured Redirect chain not probed
Network Security Intelligence
CF Cloudflare Radar Verdict Malicious
Phishing Phishing Security threats

Threat Response Pipeline

Discovery
Checks
Reports
Availability
16/16
Pre-emptive Discovery & Ingestion
Threat Ingested
1/1 ✓
Threat Ingested
telstrawebpersonalservice.framer.website detected and queued for full analysis
Oct 24, 2025
Threat Intelligence Checks
URLScan.io Snapshot · Cloudflare Radar · Web Archive · VirusTotal · Google Safe Browsing · CF Radar: Malicious · Brand Impersonation · Forensic Evidence Collected · Technical Analysis Recorded · Cloudflare Radar Scan · Content Observed Unavailable
11/11 ✓
URLScan.io Snapshot
Submitted to urlscan.io — screenshot, DOM & HTTP transactions captured
Mar 03, 2026
Cloudflare Radar
Scanned via Cloudflare Radar — DNS, certificates & network data
Web Archive
Preserved in Wayback Machine — historical evidence archived
VirusTotal
7 / 95 vendors flagged on VirusTotal
Feb 23, 2026
Google Safe Browsing
Mar 03, 2026
CF Radar: Malicious
Cloudflare Radar classified this domain as phishing, Phishing, Security threats
Brand Impersonation
Impersonation of Telstra
Forensic Evidence Collected
Stored evidence from URLScan.io, stored screenshot
Mar 03, 2026
Technical Analysis Recorded
The report contains stored technology or forensic-analysis results
Jul 28, 2026
Cloudflare Radar Scan
Scanned via Cloudflare Radar — network analysis completed
Mar 07, 2026
Content Observed Unavailable
Monitoring recorded an unavailable response (HTTP 404); the cause was not independently established
Feb 27, 2026
Notification Records
Abuse Reports Sent
1/1 ✓
Abuse Reports Sent
Abuse report sent to registrar CSC Corporate Domains, Inc., hosting provider, 1 abuse contact
domainabuse@cscglobal.com
Oct 24, 2025
Publication & Availability
DestroyList Published · Content Observed Unavailable · Time to First Unavailability
3/3 ✓
DestroyList Published
Oct 24, 2025
Content Observed Unavailable
The latest stored checks indicate that the reported content is unavailable; this does not establish who or what caused the change
Feb 27, 2026
Time to First Unavailability
3018 hours elapsed from detection to the first unavailable observation

Public Blocklist Status

1
Listed by PhishDestroy; no independent matches yet
10 external threat databases checked; 0 matched. Last synchronized Jul 28, 2026. PhishDestroy database match: confirmed.

Evidence Capture

Live Snapshot
2025-10-24 12:37 UTC
Malicious · 7/95 engines
Forensic screenshot of telstrawebpersonalservice.framer.website showing the phishing page layout
IP: 35.71.142.77
CSC Corporate Domains, Inc.
1,712d old
Page Title
Sign in with your Telstra ID

Domain Intelligence

Domaintelstrawebpersonalservice.framer.website
IP Address 35.71.142.77 US
GeoUS Seattle, US
NetworkASAS16509 · AS16509 Amazon.com, Inc.
RegistrationCreated Nov 19, 2021 Expires Nov 19, 2026
HTTP Status404 Not Found
Time to First Unavailability 126 days
What we count Elapsed time from the first stored abuse report to the first observation that telstrawebpersonalservice.framer.website was unavailable. This does not establish the cause.
What each report contains Stored outgoing report records may reference evidence available at the time, such as vendor verdicts, registration data, hosting details, classifications, or screenshots. This page does not infer the exact payload delivered, receipt, acknowledgement, or action by a recipient.
Technical detailsDNS, SSL SANs, timestamps
First DetectedOct 24, 2025
Nameserversns-1243.awsdns-27.orgns-1818.awsdns-35.co.ukns-336.awsdns-42.comns-792.awsdns-35.net
TLS Fingerprintb3445573cc07ede57a843d22babf8e3b977a95a0…
Related Campaign Members · 8 sharing fingerprint
Other tracked phishing domains sharing this site’s infrastructure fingerprint: CSC Corporate Domains, Inc. Telstra — suggests a coordinated kit / operator cluster.
smtptelstrawebmailswifttviewtelstra.framer.website
Unavailable 10 VT
swift-webmail-view.framer.website
Unavailable 14 VT
telstraautomative.framer.website
Unavailable 10 VT
telstrasystemreactivation.framer.website
Unavailable 12 VT
teltrservvisupprttttssystt.framer.website
Unavailable 12 VT
telstrawebmailautoau.framer.website
Unavailable 12 VT
telstraupdatingmailbox.framer.website
Unavailable 11 VT
telstrarecoverysystem.framer.website
Unavailable 12 VT
Explore the Domain Hub Filter hub by this fingerprint
Technologies · 4 identified
Framer Sites
React
JavaScript frameworks

JavaScript library for building user interfaces with component-based architecture.

HSTS
Security

HTTP Strict Transport Security — forces browsers to use HTTPS connections only.

HTTP/3
Miscellaneous

Third major version of HTTP protocol, built on QUIC for faster, more reliable connections.

Detected via Cloudflare Radar · Wappalyzer engine
Report This Domain Submit evidence & help protect others

VirusTotal Analysis

7 / 95 security vendors flagged this domain
View on VT
alphaMountain.ai
Forcepoint ThreatSeeker
Fortinet
Kaspersky
Phishing Database
Sophos
Webroot

Archived Evidence

Wayback Machine Snapshot
A historical snapshot is available for evidence review
View Archive

Evidence & External Reports

Were You Affected by This Site?

You are not alone and there is nothing to be ashamed of. Scammers are sophisticated criminals who exploit trust. Reporting your experience is the most powerful weapon against fraud — your report can prevent others from becoming victims and help law enforcement take action. Silence is the scammer's greatest advantage. Break it.

If you have interacted with this domain, entered personal information, or connected a cryptocurrency wallet — take immediate action. Below are resources to help you report the incident and protect yourself.

Beware of recovery scammers! After being scammed, criminals may contact you again pretending to be "recovery agents," lawyers, or investigators who claim they can retrieve your lost funds — for a fee. This is a second scam. No legitimate service will ask for upfront payment to recover stolen crypto. Learn more about recovery fraud →

Report to Your Local Authorities

Select your country to get official cybercrime contacts, or generate an AI-powered complaint →

Select your country...
180+ countries
Zero-PII — your data never leaves the browser AI writes in your language

Related Domain Reports

dsjhfjdjh-hkdfjg-4a4589.netlify.app
dsjhfjdjh-hkdfjg-4a4589.netlify.app
21 detections · Similar title
tpbpcommunitels234.framer.website
tpbpcommunitels234.framer.website
20 detections · Similar title
bewildered-quail-560005.framer.app
bewildered-quail-560005.framer.app
19 detections · Similar title
xsa.suueaiireaweeaea.com
xsa.suueaiireaweeaea.com
19 detections · Similar title
trustfundsnow.com
trustfundsnow.com
7 detections
trustfund.top
trustfund.top
12 detections
unsiker.cc
unsiker.cc
6 detections
coinbasesurveys.com
coinbasesurveys.com
15 detections

Other Domains on 35.71.142.77 6 phishing domains

This IP hosts multiple phishing domains — infrastructure shared across campaigns

creative-backgrounds-489117.framer.app favicon creative-backgrounds-489117.framer.app 24/95 formal-instance-163555.framer.app favicon formal-instance-163555.framer.app 23/95 magnificent-reflect-934880.framer.app favicon magnificent-reflect-934880.framer.app 23/95 more-report-557996.framer.app favicon more-report-557996.framer.app 22/95 started-trezorr-en.framer.ai favicon started-trezorr-en.framer.ai 22/95 happier-core-546146.framer.app favicon happier-core-546146.framer.app 22/95

More Domains at CSC 6 flagged

bafkreia2pngndebebyscsmxex5zjszaf5sdg3xso2ugg63rrsv3qqgwumu.ipfs.dweb.link favicon bafkreia2pngndebebyscsmxex5zjszaf5sdg3xso2ugg63rrsv3qqgwumu.ipfs.dweb.link 18/95 bafkreiaw5zz7ftxoid5jnlmoualalwrocb2bhg6por72ovfzstgkecdmre.ipfs.dweb.link favicon bafkreiaw5zz7ftxoid5jnlmoualalwrocb2bhg6por72ovfzstgkecdmre.ipfs.dweb.link 19/95 mckinsey.com favicon mckinsey.com bafkreidjdq2kk4ndtllvx5afsdqrhvgjqgnvj5dupbe7m65winfca7yd3a.ipfs.dweb.link favicon bafkreidjdq2kk4ndtllvx5afsdqrhvgjqgnvj5dupbe7m65winfca7yd3a.ipfs.dweb.link 16/95 bafkreia634ltaqpzfhf77yszbtr543ba4ks7mhbpuuoi6wtfofksxfxxc4.ipfs.dweb.link favicon bafkreia634ltaqpzfhf77yszbtr543ba4ks7mhbpuuoi6wtfofksxfxxc4.ipfs.dweb.link 12/95 bafybeiggrw4kkz5xjupszfsmwpytitphrqpmj4kjhu4ylgr6ubvcxksrci.ipfs.dweb.link favicon bafybeiggrw4kkz5xjupszfsmwpytitphrqpmj4kjhu4ylgr6ubvcxksrci.ipfs.dweb.link 15/95

Other Telstra Impersonation Domains

These domains also target Telstra users. View all Telstra threats →

wassss92passsso.weebly.com wassss92passsso.weebly.com 22 dsjhfjdjh-hkdfjg-4a4589.netlify.app dsjhfjdjh-hkdfjg-4a4589.netlify.app 21 tpbpcommunitels234.framer.website tpbpcommunitels234.framer.website 20 fanciful-mochi-5f3a5e.netlify.app fanciful-mochi-5f3a5e.netlify.app 19 fearless-calendar-501570.framer.app fearless-calendar-501570.framer.app 19 grounded-course-230298.framer.app grounded-course-230298.framer.app 19 earlier-concept-180784.framer.app earlier-concept-180784.framer.app 18 fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com 18

About This Report: telstrawebpersonalservice.framer.website

This report presents the latest stored evidence available to PhishDestroy. Source timestamps are shown where available; availability and vendor verdicts can change after collection.

The site displays a page titled “Sign in with your Telstra ID”, which may be designed to impersonate Telstra.

telstrawebpersonalservice.framer.website has been flagged by 7 security vendors as of July 28, 2026.

If you believe this listing is inaccurate, you can submit an appeal. For more information about our methodology, visit our FAQ page.

Check Any Domain

Threat analysis using stored blocklist, WHOIS, DNS, and public scan evidence

Scan Now

Report Phishing

Submit suspicious domains to our threat database — protect the community

Report

Live Threat Feed

Recent phishing reports and observed availability changes

Monitor

Stay Informed, Stay Safe

Monitor live threats or contest this listing if you believe it's a false positive

Live Threat Feed Appeal This Listing

Recommendations & Advice for Victims

An estimated $51 billion flowed to illicit crypto wallets in 2024 (source). If you interacted with telstrawebpersonalservice.framer.website — act now.

What should I do immediately?
Urgent
  • Revoke token approvals — use revoke.cash to remove access granted to malicious smart contracts
  • Move remaining funds to a brand-new wallet. The compromised wallet is no longer safe
  • Change all passwords — email, exchange accounts, anything that shares the same password
  • Enable 2FA using an authenticator app (not SMS). Disable SMS-based recovery
  • Freeze cards if you entered banking details on the phishing site
What information should I collect for my report?
FBI guidelines

According to the FBI, the most important details are transaction data:

  • Cryptocurrency addresses — scammer's wallet (e.g., 0x5856...35985)
  • Amount & crypto type — exact amount (e.g., 1.02345 ETH, 0.5 BTC, 500 USDT)
  • Transaction ID (hash) — the unique blockchain transaction identifier
  • Exact dates & times — of each transaction and first contact with scammer
  • Screenshots — scam website, chat messages, emails, wallet transactions, social media
  • All URLs & domains used by the scammer (including telstrawebpersonalservice.framer.website)
  • Communications — emails, texts, phone numbers, usernames the scammer used

Even if you don't have all details — file a report anyway. Partial information still helps investigations.

Where should I report the scam?
  • FBI IC3 — Internet Crime Complaint Center (US federal reporting)
  • Europol — European cybercrime reporting (EU)
  • Chainabuse — flag scam wallets across exchanges & platforms
  • Your crypto exchange — contact Coinbase/Binance/Kraken support to freeze scammer's address
  • Local police — creates an official record, even if they can't act immediately

The FBI recovered over $1 billion in crypto fraud in 2024 thanks to victim reports. Your report matters.

How do crypto scams typically work?
  • Fake websites — pixel-perfect clones of legitimate sites with slightly altered domains
  • Malicious approvals — "connect wallet" prompts that grant unlimited token spending to attackers
  • Pig butchering — trust built over weeks via Telegram/WhatsApp/dating apps, then money stolen
  • Recovery scams — victims targeted AGAIN by fake "recovery agents" demanding upfront fees. Always a scam
  • Fake ads & airdrops — Google/social media ads and "free token" offers leading to wallet drainers
  • AI-powered scams — deepfakes, automated phishing, and AI-generated sites making fraud harder to detect
How can I protect myself in the future?
  • Use a hardware wallet (Ledger, Trezor). Never store large amounts in browser wallets
  • Bookmark official sites — never click links from emails, DMs, or ads
  • Read every approval — verify permissions before signing. Reject unlimited approvals
  • Verify domains — check on PhishDestroy before interacting. Check HTTPS, spelling, domain age
  • "Too good to be true" = scam — guaranteed returns, celebrity endorsements, urgent deadlines
How big is the crypto scam problem?
  • $51 billion flowed to illicit crypto wallets in 2024 — CoinLedger
  • Pig butchering losses grew 40% year over year, now the fastest-growing fraud type
  • Only ~5% of victims report — your report helps shut down criminal networks
  • FBI recovered $1B+ in 2024 thanks to victim reports — FBI.gov

Sources: FBI · CoinLedger · WorldMetrics

Embed This Report

Share this threat intelligence on your website or blog