Перейти до звіту про безпеку
Безпека домену та аналіз загроз
directcapitalboost.com favicon

directcapitalboost.com

“Direct Capital Boost”

Загрозливий вердикт Критичний 100/100 оцінка доказів
Доступність Останній відомий активний Останнє збережене спостереження доступності
Виявлення VirusTotal: 15/89 Збережений список блокувань відповідає: 1 Уособлення бренду: Unknown Останній відомий активний
OTX: 11 refs 22.09.2026 Невідомо 1 Report Sent CDN
Actions API
⚠️
Цей домен було позначено як шкідливий
Системи безпеки повідомляють про виявлення: 15. Публічні списки блокувань, які повідомляють про збіг: 1. Будьте дуже обережні — не вводьте облікові дані чи особисту інформацію.
Огляд звіту

directcapitalboost.com — Останній відомий активний (HTTP 200). Уособлення бренду: Unknown; Тип шахрайства: Impersonation. Зведення доказів: VirusTotal 15/89 (alphaMountain.ai, BitDefender, Chong Lua Dao, CyRadar, ESET); URLQuery 3 det.; 1 external blocklist match (CryptoFirewall); PhishDestroy score 100/100. Реєстратор: GoDaddy.

Докладний аналіз PhishDestroy AI нижче залишено англійською, щоб зберегти оригінальний криміналістичний запис.

Зведення доказів

КРИТИЧНИЙ
Оцінка
100/100

Assessment
Stored evidence for directcapitalboost.com: VirusTotal recorded 15 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for directcapitalboost.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 15 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for directcapitalboost.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains directcapitalboost.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed directcapitalboost.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2024-10-08. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 160.153.0.156 as the observed address in this record. The registration date for directcapitalboost.com is recorded as 2024-10-08. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The directcapitalboost.com record states that VirusTotal recorded 15 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 160.153.0.156. The supported conclusion is bounded to the exact stored observations for directcapitalboost.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to directcapitalboost.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain directcapitalboost.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to directcapitalboost.com. The stored record does not justify extending that rule to 160.153.0.156 or to other infrastructure records.

VirusTotal
VirusTotal
15 det.
URLQuery
URLQuery
3 det.
OTX references
URLScan
URLScan
Сертифікат TLS
Google Trust Services / WE1
Вік
2 yr
Зафіксований статус
Останній відомий активний 200
PhishDestroy
DestroyList
У списку
Reports Sent
1
Обсяг даних VirusTotal 15 / 89 URLQuery 3 det. OTX 11 community references CF Radar scan completed URLScan capture збережений звіт URLScan verdict Аналіз завершено TLS valid certificate, 44d WHOIS 24 mo old Знімок екрана 3 captures · 2 sources

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as alive pointing to IP 160.153.0.156.

Процес реагування на загрози Pipeline

Відкриття
Checks
Reports
Доступність
13/14
Sent Report Recorded
Stored sent-report record for registrar GoDaddy.com, LLC, hosting provider, 1 abuse contact
abuse@godaddy.com
22.09.2026

Статус у публічних блоклистах

Аналіз виявлення та ухилення

Перевірка маскування та розподілу трафіку

Ще не відскановано Наразі не зафіксовано жодних відмінностей між роботами-павуками та браузерами

Збережені дані спостережень за взаємодією веб-сканера та браузера для цього хоста, а також перевірка відбитків у режимі реального часу для систем розподілу трафіку типу «Кейтаро».

Збережений прапор маскування
Ще не відскановано
Останнє сканування маскування
Заголовок сервера, який бачить сканер
cloudflare

Примітка щодо сканера: alive_content: raw=ok; http=200; via=https_proxy; server=cloudflare

Перевірка відбитків пальців у режимі реального часу за адресою TDS
Сім відбитків Keitaro та порівняння «краулер проти браузера», що запускаються зі сканера PhishDestroy, коли ця панель відкрита.
Очікування

Збережений знімок · 3 sources

Аналітика доменів

Домен
URLScan Verdict Аналіз завершено score 0 report ↗
Сервер / ASN cloudflare · AS209242 Cloudflare London, LLC
IP Context Cloudflare shared edge origin IP hidden Репутація Edge-IP не пов’язана з цим доменом.
OTX Tags activecampaignasciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsert+6 more
Реєстратор GoDaddy US(US)
Контакт для скаргabuse@godaddy.com
IP-адреса 160.153.0.156 CDN
ГеолокаціяUS Tempe, US
МережаAS209242 · GoDaddy.com, LLC
Зворотний пошук IPviewdns.info → rapiddns.io →
Початкова IP-адреса прихована за проксі CDN. Результати зворотного IP для крайової адреси містять непов’язаних орендарів; для пошуку джерела потрібен пасивний DNS або дані прозорості сертифіката.
РеєстраціяСтворено 08.10.2024 Expires 08.10.2026
Статус HTTP200
Технічні подробиціDNS, SAN-адреси SSL, мітки часу
Вперше виявлено22.09.2026
DOM Analysisanalyzed 23.09.2026score 98/100
IoC Extractionscanned 23.09.20260 wallet · 0 Telegram IoCs
Submitted URLhttp://directcapitalboost.com/
Сервери іменns43.domaincontrol.comns44.domaincontrol.com
MX Records1 aspmx.l.google.com 5 alt1.aspmx.l.google.com 5 alt2.aspmx.l.google.com 10 alt3.aspmx.l.google.com 10 alt4.aspmx.l.google.com
TLS Fingerprint
TLS Observationvalid from 08.08.2026scanned 23.09.2026
Favicon Hash
ID справи
Заголовок сторінки
Direct Capital Boost
Сертифікат TLS
Valid transport encryption · Виданий Google Trust Services / WE1 · valid for 44 days
Технології · 9 identified
Detected via Cloudflare Radar · Wappalyzer engine
Поскаржитися на цей домен Надішліть докази та допоможіть захистити інших

Аналіз VirusTotal

15 / 89 постачальників безпеки позначили цей домен
View on VT
Last analyzed
alphaMountain.ai
BitDefender
Chong Lua Dao
CyRadar
ESET
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
Lionic
SOCRadar
Sophos
Viettel Threat Intelligence
VIPRE
Webroot
Аналіз продуктивності сайту

Google PageSpeed Insights — mobile performance audit of directcapitalboost.com · checked Sep 22, 2026

59
Needs Work
Performance
FCP
4.52s
First Contentful Paint
LCP
6.62s
Largest Contentful Paint
CLS
0
Cumulative Layout Shift
TBT
0ms
Total Blocking Time
SI
12.9s
Speed Index
Powered by Google PageSpeed Insights · Mobile strategy · Scores: 90-100 Good 50-89 Needs Work 0-49 Poor

Докази та зовнішні звіти

Знімок надісланих доказів
Sent: Ledger records: 1 Case ID: PD-20260922-2E0C5C Recipient: abuse@godaddy.com
Page title stored with report: Direct Capital Boost
URLScan evidence VirusTotal evidence URLQuery evidence Screenshot 299.2 KB
PDF notice generated Notice text archived (650 chars)
Abuse notice text as sent to the provider
Policy Violations:
Illegal Activities: Active phishing operation targeting victims
Fraud & Deception: Impersonation of legitimate services
Identity Theft: Collection of credentials under false pretenses
Applicable Laws (Unknown):
International Anti-Cybercrime Regulations
Budapest Convention on Cybercrime
Universal Fraud Prevention Laws
Phishing activities violate international cybercrime conventions and Unknown's domestic fraud laws.
Action Required: This evidence-backed report demonstrates clear violations requiring suspension per your policies. Continued hosting exposes your organization to regulatory scrutiny and potential legal liability.

Чи вплинув на вас цей сайт?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

Якщо ви ввели облікові дані облікового запису, особисту чи платіжну інформацію або завантажили файл із цього домену, негайно вживіть заходів. Нижче наведено ресурси, які допоможуть вам повідомити про інцидент і захистити себе.

Європол
Знайдіть офіційний канал звітності для вашої країни ЄС
National police directory
Остерігайтеся шахраїв, які обіцяють повернути втрачені кошти! Злочинці можуть знову зв’язатися з жертвами, видаючи себе за слідчих, адвокатів або агентів із відновлення. Не сплачуйте авансових зборів і не діліться обліковими даними. Дізнайтеся більше про шахрайство у сфері відшкодування збитків →

Зверніться до місцевих органів влади

Виберіть свою країну, щоб отримати офіційні контакти кіберзлочинців або створити проект скарги →.

Довідник 97 країн
Чернетка за допомогою штучного інтелекту — деталі інциденту обробляються постачальником штучного інтелекту Перегляньте та подайте його самостійно

Перевірити будь-який домен

Аналіз загроз за допомогою збереженого списку блокувань, WHOIS, DNS і загальнодоступних доказів сканування

Сканувати зараз

Повідомити про фішинг

Додавайте підозрілі домени до нашої бази даних загроз — захищайте спільноту

Повідомити

Потокова стрічка про загрози

Останні звіти про фішинг і помічені зміни доступності

Відстежувати

Будьте в курсі подій, дбайте про свою безпеку

Слідкуйте за актуальними загрозами або оскаржте цей запис, якщо вважаєте, що це помилкова тривога

Потокова стрічка про загрози Оскаржити це оголошення
HTML · IFRAME

Вбудувати цей звіт

Поділіться цією інформацією про загрози на своєму веб-сайті або в блозі

embed.html
<iframe
  src="https://phishdestroy.io/uk/embed/domain/directcapitalboost.com"
  title="PhishDestroy threat report for directcapitalboost.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>