Перейти до звіту про безпеку
Безпека домену та аналіз загроз
harboradvancefunding.com favicon

harboradvancefunding.com

Загрозливий вердикт Критичний 95/100 оцінка доказів
Доступність Неперевірений Поточна доступність не перевірена
Виявлення VirusTotal: 16/89 Збережений список блокувань відповідає: 1
OTX: 11 refs 22.09.2026
Actions API
⚠️
Цей домен було позначено як шкідливий
Системи безпеки повідомляють про виявлення: 16. Публічні списки блокувань, які повідомляють про збіг: 1. Будьте дуже обережні — не вводьте облікові дані чи особисту інформацію.
Огляд звіту

harboradvancefunding.com — Неперевірений. Зведення доказів: VirusTotal 16/89 (alphaMountain.ai, Bfore.Ai PreCrime, BitDefender, Chong Lua Dao, CyRadar); URLScan capture; 1 external blocklist match (CryptoFirewall); PhishDestroy score 95/100. Реєстратор: GoDaddy.

Докладний аналіз PhishDestroy AI нижче залишено англійською, щоб зберегти оригінальний криміналістичний запис.

Зведення доказів

КРИТИЧНИЙ
Оцінка
95/100

Assessment
Stored evidence for harboradvancefunding.com: VirusTotal recorded 16 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for harboradvancefunding.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 16 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for harboradvancefunding.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains harboradvancefunding.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed harboradvancefunding.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2025-01-28. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 160.153.0.17 as the observed address in this record. The registration date for harboradvancefunding.com is recorded as 2025-01-28. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The harboradvancefunding.com record states that VirusTotal recorded 16 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 160.153.0.17. The supported conclusion is bounded to the exact stored observations for harboradvancefunding.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to harboradvancefunding.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain harboradvancefunding.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to harboradvancefunding.com. The stored record does not justify extending that rule to 160.153.0.17 or to other infrastructure records.

VirusTotal
VirusTotal
16 det.
OTX references
URLScan
URLScan
Вік
1.6 yr
Зафіксований статус
Неперевірений
PhishDestroy
DestroyList
У списку
Обсяг даних VirusTotal 16 / 89 OTX 11 community references URLScan capture збережений звіт TLS немає даних сертифіката WHOIS 20 mo old Знімок екрана 3 captures · 2 sources

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as alive pointing to IP 160.153.0.17.

Процес реагування на загрози Pipeline

Відкриття
Checks
Reports
Доступність
10/12

Статус у публічних блоклистах

Аналіз виявлення та ухилення

Перевірка маскування та розподілу трафіку

Ще не відскановано Наразі не зафіксовано жодних відмінностей між роботами-павуками та браузерами

Збережені дані спостережень за взаємодією веб-сканера та браузера для цього хоста, а також перевірка відбитків у режимі реального часу для систем розподілу трафіку типу «Кейтаро».

Збережений прапор маскування
Ще не відскановано
Перевірка відбитків пальців у режимі реального часу за адресою TDS
Сім відбитків Keitaro та порівняння «краулер проти браузера», що запускаються зі сканера PhishDestroy, коли ця панель відкрита.
Очікування

Збережений знімок · 3 sources

Аналітика доменів

Домен
OTX Tags activecampaignasciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsert+6 more
Реєстратор GoDaddy US(US)
Контакт для скаргabuse@godaddy.com
IP-адреса 160.153.0.17
Зворотний пошук IPviewdns.info → rapiddns.io →
РеєстраціяСтворено 28.01.2025 Expires 28.01.2027
Технічні подробиціDNS, SAN-адреси SSL, мітки часу
Вперше виявлено22.09.2026
Submitted URLhttp://harboradvancefunding.com/
Сервери іменns23.domaincontrol.comns24.domaincontrol.com
Favicon Hash
Поскаржитися на цей домен Надішліть докази та допоможіть захистити інших

Аналіз VirusTotal

16 / 89 постачальників безпеки позначили цей домен
View on VT
Last analyzed
alphaMountain.ai
Bfore.Ai PreCrime
BitDefender
Chong Lua Dao
CyRadar
ESET
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
Lionic
SOCRadar
Sophos
Viettel Threat Intelligence
VIPRE
Webroot

Докази та зовнішні звіти

Чи вплинув на вас цей сайт?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

Якщо ви ввели облікові дані облікового запису, особисту чи платіжну інформацію або завантажили файл із цього домену, негайно вживіть заходів. Нижче наведено ресурси, які допоможуть вам повідомити про інцидент і захистити себе.

Європол
Знайдіть офіційний канал звітності для вашої країни ЄС
National police directory
Остерігайтеся шахраїв, які обіцяють повернути втрачені кошти! Злочинці можуть знову зв’язатися з жертвами, видаючи себе за слідчих, адвокатів або агентів із відновлення. Не сплачуйте авансових зборів і не діліться обліковими даними. Дізнайтеся більше про шахрайство у сфері відшкодування збитків →

Зверніться до місцевих органів влади

Виберіть свою країну, щоб отримати офіційні контакти кіберзлочинців або створити проект скарги →.

Довідник 97 країн
Чернетка за допомогою штучного інтелекту — деталі інциденту обробляються постачальником штучного інтелекту Перегляньте та подайте його самостійно

Перевірити будь-який домен

Аналіз загроз за допомогою збереженого списку блокувань, WHOIS, DNS і загальнодоступних доказів сканування

Сканувати зараз

Повідомити про фішинг

Додавайте підозрілі домени до нашої бази даних загроз — захищайте спільноту

Повідомити

Потокова стрічка про загрози

Останні звіти про фішинг і помічені зміни доступності

Відстежувати

Будьте в курсі подій, дбайте про свою безпеку

Слідкуйте за актуальними загрозами або оскаржте цей запис, якщо вважаєте, що це помилкова тривога

Потокова стрічка про загрози Оскаржити це оголошення
HTML · IFRAME

Вбудувати цей звіт

Поділіться цією інформацією про загрози на своєму веб-сайті або в блозі

embed.html
<iframe
  src="https://phishdestroy.io/uk/embed/domain/harboradvancefunding.com"
  title="PhishDestroy threat report for harboradvancefunding.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>