smtptelstrawebmailswiftviewtelstrawebmailswiftwebmail[.]framer[.]website
Domain Security & Threat Intelligence Report“Sign in with your Telstra ID”
US
+ more
This phishing campaign leverages brand trust by mimicking the Telstra login interface, encouraging victims to enter their Telstra ID. The domain resolves to an IP address in Singapore and was registered using CSC Corporate Domains Inc. It fooled multiple security vendors, with 13 raising alerts. The site’s presence on at least one security blocklist further confirms its malicious intent.
To stay safe, users should avoid interacting with suspicious URLs, especially those that attempt to mimic trusted brands like Telstra. Always verify web addresses carefully before entering credentials. Utilizing official channels and enabling multi-factor authentication on accounts can mitigate risks from such scams. Reporting suspicious sites to authorities or security platforms helps prevent further victimization.
Network Security Intelligence
Cloudflare Radar Verdict
Malicious
Threat Response Pipeline
Public Blocklist Status
Evidence Capture
CSC Corporate Domains, Inc.Domain Intelligence
CSC
(US)
Technical detailsDNS, SSL SANs, timestamps
Related Campaign Members · 8 sharing fingerprint
Technologies · 4 identified
JavaScript library for building user interfaces with component-based architecture.
HTTP Strict Transport Security — forces browsers to use HTTPS connections only.
Third major version of HTTP protocol, built on QUIC for faster, more reliable connections.
VirusTotal Analysis
Archived Evidence
Evidence & External Reports
Were You Affected by This Site?
If you have interacted with this domain, entered personal information, or connected a cryptocurrency wallet — take immediate action. Below are resources to help you report the incident and protect yourself.
Report to Your Local Authorities
Select your country to get official cybercrime contacts, or generate an AI-powered complaint →
Related Domain Reports
Other Domains on 52.223.52.2 6 phishing domains
This IP hosts multiple phishing domains — infrastructure shared across campaigns
sharp-aim-536555.framer.app 
magenta-tenets-857917.framer.app 
magnificent-reflect-934880.framer.app 
formal-instance-163555.framer.app 
started-trezorr-en.framer.ai 
startedtrzerr-io-us.framer.ai More Domains at CSC 6 flagged
bafkreibawwibszeisgf7jarjpm3p2qeze6nejxl3p2hbioadratcofntgm.ipfs.dweb.link 
bafybeifhkli7dfi6brfwr3637krztfkps6yf26wqe45ks7mq23jkrg5pzm.ipfs.dweb.link 
sol.com 
yumi.framer.ai 
yumifinance.framer.ai 
bafybeiclh4rdjgenba3udk2t6t7k6mg2xhf5z6vspwffh4vtbgqqrfwbwe.ipfs.dweb.link Other Telstra Impersonation Domains
These domains also target Telstra users. View all Telstra threats →
dsjhfjdjh-hkdfjg-4a4589.netlify.app 21
tpbpcommunitels234.framer.website 20
fanciful-mochi-5f3a5e.netlify.app 19
fearless-calendar-501570.framer.app 19
grounded-course-230298.framer.app 19
myid-telstra.flutterflow.app 19
earlier-concept-180784.framer.app 18
fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com 18
About This Report: smtptelstrawebmailswiftviewtelstrawebmailswiftwebmail.framer.website
This domain security report for smtptelstrawebmailswiftviewtelstrawebmailswiftwebmail.framer.website is maintained by PhishDestroy's automated threat intelligence pipeline. Our system continuously monitors this domain across 13 security vendors on VirusTotal, 1 public blocklists, URLScan.io.
The site displays a page titled “Sign in with your Telstra ID”, which may be designed to impersonate Telstra.
smtptelstrawebmailswiftviewtelstrawebmailswiftwebmail.framer.website has been flagged by 13 security vendors as of April 21, 2026.
If you believe this listing is inaccurate, you can submit an appeal. For more information about our methodology, visit our FAQ page.
Check Any Domain
Instant threat analysis with 50+ security engines, AI classification & forensic evidence
Scan NowReport Phishing
Submit suspicious domains to our threat database — protect the community
ReportLive Threat Feed
Real-time monitoring of active phishing campaigns & takedown progress
MonitorStay Informed, Stay Safe
Monitor live threats or contest this listing if you believe it's a false positive
Recommendations & Advice for Victims
An estimated $51 billion flowed to illicit crypto wallets in 2024 (source). If you interacted with smtptelstrawebmailswiftviewtelstrawebmailswiftwebmail.framer.website — act now.
What should I do immediately?
Urgent
- Revoke token approvals — use revoke.cash to remove access granted to malicious smart contracts
- Move remaining funds to a brand-new wallet. The compromised wallet is no longer safe
- Change all passwords — email, exchange accounts, anything that shares the same password
- Enable 2FA using an authenticator app (not SMS). Disable SMS-based recovery
- Freeze cards if you entered banking details on the phishing site
What information should I collect for my report?
FBI guidelines
According to the FBI, the most important details are transaction data:
- Cryptocurrency addresses — scammer's wallet (e.g.,
0x5856...35985) - Amount & crypto type — exact amount (e.g., 1.02345 ETH, 0.5 BTC, 500 USDT)
- Transaction ID (hash) — the unique blockchain transaction identifier
- Exact dates & times — of each transaction and first contact with scammer
- Screenshots — scam website, chat messages, emails, wallet transactions, social media
- All URLs & domains used by the scammer (including
smtptelstrawebmailswiftviewtelstrawebmailswiftwebmail.framer.website) - Communications — emails, texts, phone numbers, usernames the scammer used
Even if you don't have all details — file a report anyway. Partial information still helps investigations.
Where should I report the scam?
- FBI IC3 — Internet Crime Complaint Center (US federal reporting)
- Europol — European cybercrime reporting (EU)
- Chainabuse — flag scam wallets across exchanges & platforms
- Your crypto exchange — contact Coinbase/Binance/Kraken support to freeze scammer's address
- Local police — creates an official record, even if they can't act immediately
The FBI recovered over $1 billion in crypto fraud in 2024 thanks to victim reports. Your report matters.
How do crypto scams typically work?
- Fake websites — pixel-perfect clones of legitimate sites with slightly altered domains
- Malicious approvals — "connect wallet" prompts that grant unlimited token spending to attackers
- Pig butchering — trust built over weeks via Telegram/WhatsApp/dating apps, then money stolen
- Recovery scams — victims targeted AGAIN by fake "recovery agents" demanding upfront fees. Always a scam
- Fake ads & airdrops — Google/social media ads and "free token" offers leading to wallet drainers
- AI-powered scams — deepfakes, automated phishing, and AI-generated sites making fraud harder to detect
How can I protect myself in the future?
- Use a hardware wallet (Ledger, Trezor). Never store large amounts in browser wallets
- Bookmark official sites — never click links from emails, DMs, or ads
- Read every approval — verify permissions before signing. Reject unlimited approvals
- Verify domains — check on PhishDestroy before interacting. Check HTTPS, spelling, domain age
- "Too good to be true" = scam — guaranteed returns, celebrity endorsements, urgent deadlines
How big is the crypto scam problem?
- $51 billion flowed to illicit crypto wallets in 2024 — CoinLedger
- Pig butchering losses grew 40% year over year, now the fastest-growing fraud type
- Only ~5% of victims report — your report helps shut down criminal networks
- FBI recovered $1B+ in 2024 thanks to victim reports — FBI.gov
Sources: FBI · CoinLedger · WorldMetrics