Chuyển đến báo cáo bảo mật
Bảo mật miền và thông tin về mối đe dọa
onlinedirectfinance.com favicon

onlinedirectfinance.com

Phán quyết đe dọa Quan trọng 89/100 điểm bằng chứng
sẵn có Chưa được xác minh Khả năng tiếp cận hiện tại chưa được xác minh
Tổng số phát hiện Virus: 13/89 Danh sách chặn trùng khớp được lưu trữ: 1
OTX: 11 refs 22/09/2026
Actions API
⚠️
Tên miền này đã bị đánh dấu là có hại
Công cụ bảo mật báo cáo phát hiện: 13. Danh sách chặn công khai báo cáo trận đấu: 1. Hãy hết sức thận trọng — không nhập thông tin xác thực hoặc thông tin cá nhân.
Tóm tắt báo cáo

onlinedirectfinance.com — Chưa được xác minh. Tóm tắt bằng chứng: VirusTotal 13/89 (alphaMountain.ai, Chong Lua Dao, CyRadar, Forcepoint ThreatSeeker, Fortinet); URLScan capture; 1 external blocklist match (CryptoFirewall); PhishDestroy score 89/100. Nhà đăng ký: GoDaddy.

Phân tích chi tiết của PhishDestroy AI bên dưới được giữ bằng tiếng Anh để bảo toàn hồ sơ pháp chứng gốc.

Tóm tắt bằng chứng

QUAN TRỌNG
Điểm
89/100

Assessment
Stored evidence for onlinedirectfinance.com: VirusTotal recorded 13 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for onlinedirectfinance.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 13 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for onlinedirectfinance.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains onlinedirectfinance.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed onlinedirectfinance.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2021-05-13. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 192.169.222.135 as the observed address in this record. The registration date for onlinedirectfinance.com is recorded as 2021-05-13. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The onlinedirectfinance.com record states that VirusTotal recorded 13 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 192.169.222.135. The supported conclusion is bounded to the exact stored observations for onlinedirectfinance.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to onlinedirectfinance.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain onlinedirectfinance.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to onlinedirectfinance.com. The stored record does not justify extending that rule to 192.169.222.135 or to other infrastructure records.

VirusTotal
VirusTotal
13 det.
OTX references
URLScan
URLScan
Tuổi
5.4 yr
Trạng thái ghi nhận
Chưa được xác minh
PhishDestroy
Danh sách hủy bỏ
Có trong danh sách
Phạm vi dữ liệu VirusTotal 13 / 89 OTX 11 community references URLScan capture báo cáo được lưu trữ TLS không có dữ liệu chứng chỉ WHOIS 65 mo old Ảnh chụp màn hình 3 captures · 2 sources

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as unknown pointing to IP 192.169.222.135.

Pipeline ứng phó với các mối đe dọa

Khám phá
Checks
Reports
Khả dụng
10/12

Trạng thái trong danh sách chặn công khai

Phân tích phát hiện và né tránh

Kiểm tra tính năng ẩn trang và phân phối lưu lượng truy cập

Chưa được quét Hiện tại vẫn chưa ghi nhận sự khác biệt nào giữa trình thu thập dữ liệu và trình duyệt

Các dữ liệu quan sát đã lưu trữ về sự so sánh giữa trình thu thập dữ liệu và trình duyệt đối với máy chủ này, cùng với việc kiểm tra dấu vân tay thời gian thực dành cho các hệ thống phân phối lưu lượng theo phong cách Keitaro.

Cờ ẩn được lưu trữ
Chưa được quét
Kiểm tra dấu vân tay trực tiếp trên TDS
Bảy dấu vân tay Keitaro cùng với so sánh giữa trình thu thập dữ liệu và trình duyệt, được thực hiện từ trình quét PhishDestroy khi bảng điều khiển này đang mở.
Chờ đợi

Bản chụp đã lưu · 3 sources

Thông tin về tên miền

Tên miền
OTX Tags activecampaignasciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsert+6 more
Nhà đăng ký GoDaddy US(US)
Liên hệ báo cáo lạm dụngabuse@godaddy.com
Địa chỉ IP 192.169.222.135
Đăng kýĐược tạo 13/05/2021 Expires 13/05/2027
Chi tiết kỹ thuậtDNS, SAN trong SSL, dấu thời gian
Lần đầu tiên được phát hiện22/09/2026
Submitted URLhttp://onlinedirectfinance.com/
Máy chủ tênns45.domaincontrol.comns46.domaincontrol.com
Favicon Hash
Báo cáo tên miền này Gửi bằng chứng và góp phần bảo vệ người khác

Phân tích của VirusTotal

13 / Nhà cung cấp bảo mật 89 đã gắn cờ miền này
View on VT
Last analyzed
alphaMountain.ai
Chong Lua Dao
CyRadar
Forcepoint ThreatSeeker
Fortinet
Gridinsoft
Lionic
Seclookup
SOCRadar
Sophos
Viettel Threat Intelligence
VIPRE
Webroot
Phân tích hiệu suất trang

Google PageSpeed Insights — mobile performance audit of onlinedirectfinance.com · checked Sep 22, 2026

61
Needs Work
Performance
FCP
4.5s
First Contentful Paint
LCP
9.55s
Largest Contentful Paint
CLS
0.037
Cumulative Layout Shift
TBT
0ms
Total Blocking Time
SI
6.3s
Speed Index
Powered by Google PageSpeed Insights · Mobile strategy · Scores: 90-100 Good 50-89 Needs Work 0-49 Poor

Bằng chứng và các báo cáo bên ngoài

Bạn có bị ảnh hưởng bởi trang web này không?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

Nếu bạn đã nhập thông tin xác thực tài khoản, thông tin cá nhân hoặc thông tin thanh toán hoặc đã tải xuống tệp từ miền này, hãy hành động ngay lập tức. Dưới đây là các nguồn lực giúp bạn báo cáo vụ việc và bảo vệ chính mình.

Europol
Tìm kênh báo cáo chính thức cho quốc gia EU của bạn
National police directory
Hãy cảnh giác với những kẻ lừa đảo lợi dụng việc phục hồi dữ liệu! Tội phạm có thể liên hệ lại với nạn nhân trong khi giả làm điều tra viên, luật sư hoặc nhân viên phục hồi. Không trả phí trả trước hoặc chia sẻ thông tin đăng nhập. Tìm hiểu thêm về gian lận trong quá trình phục hồi →

Hãy báo cáo với chính quyền địa phương

Chọn quốc gia của bạn để nhận liên hệ tội phạm mạng chính thức hoặc soạn thảo đơn khiếu nại →.

Danh mục 97 quốc gia
Bản nháp có sự hỗ trợ của AI - chi tiết sự cố được nhà cung cấp AI xử lý Hãy tự mình xem xét và gửi nó

Kiểm tra bất kỳ tên miền nào

Phân tích mối đe dọa bằng cách sử dụng danh sách chặn được lưu trữ, WHOIS, DNS và bằng chứng quét công khai

Quét ngay

Báo cáo lừa đảo qua email

Hãy gửi các tên miền đáng ngờ đến cơ sở dữ liệu mối đe dọa của chúng tôi — để bảo vệ cộng đồng

Báo cáo

Dòng tin tức về các mối đe dọa thời gian thực

Các báo cáo lừa đảo gần đây và những thay đổi về tính khả dụng được quan sát thấy

Theo dõi

Luôn cập nhật thông tin, luôn an toàn

Theo dõi các mối đe dọa đang diễn ra hoặc phản đối danh sách này nếu bạn cho rằng đây là kết quả báo động sai

Dòng tin tức về các mối đe dọa thời gian thực Khiếu nại về thông tin đăng tải này
HTML · IFRAME

Nhúng báo cáo này

Hãy chia sẻ thông tin tình báo về mối đe dọa này trên trang web hoặc blog của bạn

embed.html
<iframe
  src="https://phishdestroy.io/vi/embed/domain/onlinedirectfinance.com"
  title="PhishDestroy threat report for onlinedirectfinance.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>