Chuyển đến báo cáo bảo mật
Bảo mật miền và thông tin về mối đe dọa
directcapitalboost.com favicon

directcapitalboost.com

“Direct Capital Boost”

Phán quyết đe dọa Quan trọng 100/100 điểm bằng chứng
sẵn có Hoạt động được biết đến lần cuối Quan sát khả năng tiếp cận được lưu trữ mới nhất
Tổng số phát hiện Virus: 15/89 Danh sách chặn trùng khớp được lưu trữ: 1 Mạo danh thương hiệu: Unknown Hoạt động được biết đến lần cuối
OTX: 11 refs 22/09/2026 Không rõ 1 Report Sent CDN
Actions API
⚠️
Tên miền này đã bị đánh dấu là có hại
Công cụ bảo mật báo cáo phát hiện: 15. Danh sách chặn công khai báo cáo trận đấu: 1. Hãy hết sức thận trọng — không nhập thông tin xác thực hoặc thông tin cá nhân.
Tóm tắt báo cáo

directcapitalboost.com — Hoạt động được biết đến lần cuối (HTTP 200). Mạo danh thương hiệu: Unknown; Loại lừa đảo: Impersonation. Tóm tắt bằng chứng: VirusTotal 15/89 (alphaMountain.ai, BitDefender, Chong Lua Dao, CyRadar, ESET); URLQuery 3 det.; 1 external blocklist match (CryptoFirewall); PhishDestroy score 100/100. Nhà đăng ký: GoDaddy.

Phân tích chi tiết của PhishDestroy AI bên dưới được giữ bằng tiếng Anh để bảo toàn hồ sơ pháp chứng gốc.

Tóm tắt bằng chứng

QUAN TRỌNG
Điểm
100/100

Assessment
Stored evidence for directcapitalboost.com: VirusTotal recorded 15 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for directcapitalboost.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 15 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for directcapitalboost.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains directcapitalboost.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed directcapitalboost.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2024-10-08. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 160.153.0.156 as the observed address in this record. The registration date for directcapitalboost.com is recorded as 2024-10-08. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The directcapitalboost.com record states that VirusTotal recorded 15 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 160.153.0.156. The supported conclusion is bounded to the exact stored observations for directcapitalboost.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to directcapitalboost.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain directcapitalboost.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to directcapitalboost.com. The stored record does not justify extending that rule to 160.153.0.156 or to other infrastructure records.

VirusTotal
VirusTotal
15 det.
URLQuery
URLQuery
3 det.
OTX references
URLScan
URLScan
Chứng chỉ TLS
Google Trust Services / WE1
Tuổi
2 yr
Trạng thái ghi nhận
Hoạt động được biết đến lần cuối 200
PhishDestroy
Danh sách hủy bỏ
Có trong danh sách
Reports Sent
1
Phạm vi dữ liệu VirusTotal 15 / 89 URLQuery 3 det. OTX 11 community references CF Radar scan completed URLScan capture báo cáo được lưu trữ URLScan verdict Phân tích hoàn tất TLS valid certificate, 44d WHOIS 24 mo old Ảnh chụp màn hình 3 captures · 2 sources

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as alive pointing to IP 160.153.0.156.

Pipeline ứng phó với các mối đe dọa

Khám phá
Checks
Reports
Khả dụng
13/14
Sent Report Recorded
Stored sent-report record for registrar GoDaddy.com, LLC, hosting provider, 1 abuse contact
abuse@godaddy.com
22/09/2026

Trạng thái trong danh sách chặn công khai

Phân tích phát hiện và né tránh

Kiểm tra tính năng ẩn trang và phân phối lưu lượng truy cập

Chưa được quét Hiện tại vẫn chưa ghi nhận sự khác biệt nào giữa trình thu thập dữ liệu và trình duyệt

Các dữ liệu quan sát đã lưu trữ về sự so sánh giữa trình thu thập dữ liệu và trình duyệt đối với máy chủ này, cùng với việc kiểm tra dấu vân tay thời gian thực dành cho các hệ thống phân phối lưu lượng theo phong cách Keitaro.

Cờ ẩn được lưu trữ
Chưa được quét
Lần quét che giấu gần nhất
Tiêu đề máy chủ được trình quét phát hiện
cloudflare

Ghi chú về máy quét: alive_content: raw=ok; http=200; via=https_proxy; server=cloudflare

Kiểm tra dấu vân tay trực tiếp trên TDS
Bảy dấu vân tay Keitaro cùng với so sánh giữa trình thu thập dữ liệu và trình duyệt, được thực hiện từ trình quét PhishDestroy khi bảng điều khiển này đang mở.
Chờ đợi

Bản chụp đã lưu · 3 sources

Thông tin về tên miền

Tên miền
URLScan Verdict Phân tích hoàn tất score 0 report ↗
Máy chủ / ASN cloudflare · AS209242 Cloudflare London, LLC
IP Context Cloudflare shared edge origin IP hidden Danh tiếng của Edge-IP không được quy cho tên miền này.
OTX Tags activecampaignasciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsert+6 more
Nhà đăng ký GoDaddy US(US)
Liên hệ báo cáo lạm dụngabuse@godaddy.com
Địa chỉ IP 160.153.0.156 CDN
Vị tríUS Tempe, US
MạngAS209242 · GoDaddy.com, LLC
IP gốc được ẩn sau proxy CDN. Kết quả IP đảo ngược cho địa chỉ biên chứa các đối tượng thuê không liên quan; việc tìm kiếm nguồn gốc yêu cầu dữ liệu DNS thụ động hoặc tính minh bạch của chứng chỉ.
Đăng kýĐược tạo 08/10/2024 Expires 08/10/2026
Trạng thái HTTP200
Chi tiết kỹ thuậtDNS, SAN trong SSL, dấu thời gian
Lần đầu tiên được phát hiện22/09/2026
DOM Analysisanalyzed 23/09/2026score 98/100
IoC Extractionscanned 23/09/20260 wallet · 0 Telegram IoCs
Submitted URLhttp://directcapitalboost.com/
Máy chủ tênns43.domaincontrol.comns44.domaincontrol.com
MX Records1 aspmx.l.google.com 5 alt1.aspmx.l.google.com 5 alt2.aspmx.l.google.com 10 alt3.aspmx.l.google.com 10 alt4.aspmx.l.google.com
TLS Fingerprint
TLS Observationvalid from 08/08/2026scanned 23/09/2026
Favicon Hash
Mã vụ việc
Tiêu đề trang
Direct Capital Boost
Chứng chỉ TLS
Valid transport encryption · Được cấp bởi Google Trust Services / WE1 · valid for 44 days
Công nghệ · 9 identified
Detected via Cloudflare Radar · Wappalyzer engine
Báo cáo tên miền này Gửi bằng chứng và góp phần bảo vệ người khác

Phân tích của VirusTotal

15 / Nhà cung cấp bảo mật 89 đã gắn cờ miền này
View on VT
Last analyzed
alphaMountain.ai
BitDefender
Chong Lua Dao
CyRadar
ESET
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
Lionic
SOCRadar
Sophos
Viettel Threat Intelligence
VIPRE
Webroot
Phân tích hiệu suất trang

Google PageSpeed Insights — mobile performance audit of directcapitalboost.com · checked Sep 22, 2026

59
Needs Work
Performance
FCP
4.52s
First Contentful Paint
LCP
6.62s
Largest Contentful Paint
CLS
0
Cumulative Layout Shift
TBT
0ms
Total Blocking Time
SI
12.9s
Speed Index
Powered by Google PageSpeed Insights · Mobile strategy · Scores: 90-100 Good 50-89 Needs Work 0-49 Poor

Bằng chứng và các báo cáo bên ngoài

Ảnh chụp bằng chứng đã gửi
Sent: Ledger records: 1 Case ID: PD-20260922-2E0C5C Recipient: abuse@godaddy.com
Page title stored with report: Direct Capital Boost
URLScan evidence VirusTotal evidence URLQuery evidence Screenshot 299.2 KB
PDF notice generated Notice text archived (650 chars)
Abuse notice text as sent to the provider
Policy Violations:
Illegal Activities: Active phishing operation targeting victims
Fraud & Deception: Impersonation of legitimate services
Identity Theft: Collection of credentials under false pretenses
Applicable Laws (Unknown):
International Anti-Cybercrime Regulations
Budapest Convention on Cybercrime
Universal Fraud Prevention Laws
Phishing activities violate international cybercrime conventions and Unknown's domestic fraud laws.
Action Required: This evidence-backed report demonstrates clear violations requiring suspension per your policies. Continued hosting exposes your organization to regulatory scrutiny and potential legal liability.

Bạn có bị ảnh hưởng bởi trang web này không?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

Nếu bạn đã nhập thông tin xác thực tài khoản, thông tin cá nhân hoặc thông tin thanh toán hoặc đã tải xuống tệp từ miền này, hãy hành động ngay lập tức. Dưới đây là các nguồn lực giúp bạn báo cáo vụ việc và bảo vệ chính mình.

Europol
Tìm kênh báo cáo chính thức cho quốc gia EU của bạn
National police directory
Hãy cảnh giác với những kẻ lừa đảo lợi dụng việc phục hồi dữ liệu! Tội phạm có thể liên hệ lại với nạn nhân trong khi giả làm điều tra viên, luật sư hoặc nhân viên phục hồi. Không trả phí trả trước hoặc chia sẻ thông tin đăng nhập. Tìm hiểu thêm về gian lận trong quá trình phục hồi →

Hãy báo cáo với chính quyền địa phương

Chọn quốc gia của bạn để nhận liên hệ tội phạm mạng chính thức hoặc soạn thảo đơn khiếu nại →.

Danh mục 97 quốc gia
Bản nháp có sự hỗ trợ của AI - chi tiết sự cố được nhà cung cấp AI xử lý Hãy tự mình xem xét và gửi nó

Kiểm tra bất kỳ tên miền nào

Phân tích mối đe dọa bằng cách sử dụng danh sách chặn được lưu trữ, WHOIS, DNS và bằng chứng quét công khai

Quét ngay

Báo cáo lừa đảo qua email

Hãy gửi các tên miền đáng ngờ đến cơ sở dữ liệu mối đe dọa của chúng tôi — để bảo vệ cộng đồng

Báo cáo

Dòng tin tức về các mối đe dọa thời gian thực

Các báo cáo lừa đảo gần đây và những thay đổi về tính khả dụng được quan sát thấy

Theo dõi

Luôn cập nhật thông tin, luôn an toàn

Theo dõi các mối đe dọa đang diễn ra hoặc phản đối danh sách này nếu bạn cho rằng đây là kết quả báo động sai

Dòng tin tức về các mối đe dọa thời gian thực Khiếu nại về thông tin đăng tải này
HTML · IFRAME

Nhúng báo cáo này

Hãy chia sẻ thông tin tình báo về mối đe dọa này trên trang web hoặc blog của bạn

embed.html
<iframe
  src="https://phishdestroy.io/vi/embed/domain/directcapitalboost.com"
  title="PhishDestroy threat report for directcapitalboost.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>