Перейти к отчёту о безопасности
Безопасность домена и анализ угроз
ourbusinessloans.com favicon

ourbusinessloans.com

“Our Business Loans – Quick”

Вердикт по угрозе Критический 90/100 оценка доказательств
Доступность Последний известный активный Последнее сохраненное наблюдение о доступности
Всего обнаружений вирусов: 8/89 Сохраненные совпадения в черном списке: 1. Олицетворение бренда: Unknown Последний известный активный
OTX: 10 refs 22.09.2026 Неизвестно 1 Report Sent CDN
Actions API
⚠️
Этот домен был отмечен как вредоносный
Механизмы безопасности сообщают об обнаружении: 8. Публичные черные списки, сообщающие о совпадении: 1. Будьте предельно осторожны — не вводите учетные данные или личную информацию.
Краткий обзор отчёта

ourbusinessloans.com — Последний известный активный (HTTP 200). Олицетворение бренда: Unknown; Тип мошенничества: Impersonation. Сводка доказательств: VirusTotal 8/89 (alphaMountain.ai, BitDefender, Forcepoint ThreatSeeker, Fortinet, G-Data); URLQuery 2 det.; 1 external blocklist match (CryptoFirewall); PhishDestroy score 90/100. Регистратор: GoDaddy.

Подробный анализ PhishDestroy AI ниже оставлен на английском, чтобы сохранить исходную криминалистическую запись.

Сводка доказательств

КРИТИЧЕСКИЙ
Оценка
90/100

Assessment
Stored evidence for ourbusinessloans.com: VirusTotal recorded 8 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for ourbusinessloans.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 8 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for ourbusinessloans.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains ourbusinessloans.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed ourbusinessloans.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2021-07-29. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 160.153.0.178 as the observed address in this record. The registration date for ourbusinessloans.com is recorded as 2021-07-29. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The ourbusinessloans.com record states that VirusTotal recorded 8 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 160.153.0.178. The supported conclusion is bounded to the exact stored observations for ourbusinessloans.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to ourbusinessloans.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain ourbusinessloans.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to ourbusinessloans.com. The stored record does not justify extending that rule to 160.153.0.178 or to other infrastructure records.

VirusTotal
VirusTotal
8 det.
URLQuery
URLQuery
2 det.
OTX references
Сертификат TLS
Google Trust Services / WE1
Возраст
5.2 yr
Зафиксированный статус
Последний известный активный 200
PhishDestroy
DestroyList
В списке
Reports Sent
1
Охват данных VirusTotal 8 / 89 URLQuery 2 det. OTX 10 community references CF Radar scan completed URLScan capture сохраненный отчет URLScan verdict Анализ завершён TLS valid certificate, 80d WHOIS 63 mo old Снимок экрана 3 captures · 2 sources

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as alive pointing to IP 160.153.0.178.

Процесс реагирования на угрозы

Открытие
Checks
Reports
Доступность
13/14
Sent Report Recorded
Stored sent-report record for registrar GoDaddy.com, LLC, hosting provider, 1 abuse contact
abuse@godaddy.com
22.09.2026

Статус в публичных блок-листах

Анализ методов обнаружения и уклонения

Подозрение на маскировку: названия сканера и посетителя не совпадают

Еще не отсканировано Пока не было зафиксировано никаких различий между роботом-пауком и браузером

Сохраненные данные сравнения данных сканера и браузера для данного хоста, а также проверка отпечатков в режиме реального времени для систем распределения трафика типа «Кейтаро».

Сохраненный флаг маскировки
Еще не отсканировано
Последнее сканирование на наличие маскировки
Заголовок сервера, видимый сканером
cloudflare

Примечание к сканированию: alive_content: raw=ok; http=200; via=https_proxy; server=cloudflare

Название, отображаемое на сканере безопасностиOur Business Loans – Quick & Flexible Business Loans
Заголовок, отображаемый посетителям браузераOur Business Loans – Quick
Проверка отпечатков пальцев в режиме реального времени с помощью «TDS»
Семь отпечатков Keitaro, а также сравнение кроулера и браузера — запускаются со сканера PhishDestroy при открытии этой панели.
Ожидание

Сохранённый снимок · 3 sources

Аналитика доменов

Домен
URLScan Verdict Анализ завершён score 0 report ↗
Сервер / ASN cloudflare · AS209242 Cloudflare London, LLC
IP Context Cloudflare shared edge origin IP hidden Репутация Edge-IP не связана с этим доменом.
OTX Tags asciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsertinvisible characters+6 more
Регистратор GoDaddy US(US)
IP-адрес 160.153.0.178 CDN
ГеолокацияUS Tempe, US
СетьAS209242 · GoDaddy.com, LLC
Обратный поиск IPviewdns.info → rapiddns.io →
Исходный IP-адрес скрыт за прокси-сервером CDN. Результаты обратного IP-адреса для граничного адреса содержат несвязанных клиентов; для определения источника требуется пассивный DNS или данные прозрачности сертификатов.
РегистрацияСоздано 29.07.2021 Expires 29.07.2027
Статус HTTP200
Технические деталиDNS, SAN в протоколе SSL, временные метки
Впервые обнаружено22.09.2026
DOM Analysisanalyzed 23.09.2026score 88/100
IoC Extractionscanned 23.09.20260 wallet · 0 Telegram IoCs
Submitted URLhttp://ourbusinessloans.com/
Серверы имёнns13.domaincontrol.comns14.domaincontrol.com
MX Records1 aspmx.l.google.com 5 alt2.aspmx.l.google.com 5 alt1.aspmx.l.google.com 10 alt4.aspmx.l.google.com 10 alt3.aspmx.l.google.com
TLS Fingerprint
TLS Observationvalid from 14.09.2026scanned 23.09.2026
Favicon Hash
ID дела
Заголовок страницы
Our Business Loans – Quick
Сертификат TLS
Valid transport encryption · Выдан Google Trust Services / WE1 · valid for 80 days
Технологии · 12 identified
Detected via Cloudflare Radar · Wappalyzer engine
Пожаловаться на этот домен Предоставьте доказательства и помогите защитить других

Анализ VirusTotal

8 / Поставщики средств безопасности 89 отметили этот домен
View on VT
Last analyzed
alphaMountain.ai
BitDefender
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
SOCRadar
Sophos

Доказательства и внешние отчеты

Снимок отправленных доказательств
Sent: Ledger records: 1 Case ID: PD-20260922-510AF7 Recipient: abuse@godaddy.com
Page title stored with report: Our Business Loans – Quick & Flexible Business Loans
URLScan evidence VirusTotal evidence URLQuery evidence Screenshot 582.6 KB
PDF notice generated Notice text archived (650 chars)
Abuse notice text as sent to the provider
Policy Violations:
Illegal Activities: Active phishing operation targeting victims
Fraud & Deception: Impersonation of legitimate services
Identity Theft: Collection of credentials under false pretenses
Applicable Laws (Unknown):
International Anti-Cybercrime Regulations
Budapest Convention on Cybercrime
Universal Fraud Prevention Laws
Phishing activities violate international cybercrime conventions and Unknown's domestic fraud laws.
Action Required: This evidence-backed report demonstrates clear violations requiring suspension per your policies. Continued hosting exposes your organization to regulatory scrutiny and potential legal liability.

Повлиял ли на вас этот сайт?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

Если вы ввели учетные данные, личную или платежную информацию или загрузили файл с этого домена, примите немедленные меры. Ниже приведены ресурсы, которые помогут вам сообщить об инциденте и защитить себя.

Европол
Найдите официальный канал отчетности для вашей страны ЕС
National police directory
Остерегайтесь мошенников, предлагающих услуги по восстановлению данных! Преступники могут снова связаться с жертвами, притворяясь следователями, адвокатами или агентами по восстановлению. Не платите авансовые платежи и не делитесь учетными данными. Узнайте больше о мошенничестве при получении компенсаций →

Сообщите об этом в местные органы власти

Выберите свою страну, чтобы получить официальные контакты по киберпреступности или создать проект жалобы →.

Каталог 97 стран
Черновик по шаблону • помощь AI с формулировками включается только с отдельного согласия. Просмотрите и отправьте его самостоятельно

Проверить любой домен

Анализ угроз с использованием сохраненного черного списка, WHOIS, DNS и общедоступных доказательств сканирования.

Сканировать сейчас

Сообщить о фишинге

Добавляйте подозрительные домены в нашу базу данных угроз — защищайте сообщество

Сообщить

Поток оперативных данных об угрозах

Недавние сообщения о фишинге и наблюдаемые изменения доступности

Отслеживать

Будьте в курсе событий, берегите себя

Отслеживайте актуальные угрозы или оспорьте эту запись, если считаете, что это ложное срабатывание

Поток оперативных данных об угрозах Подать жалобу на это объявление
HTML · IFRAME

Вставить этот отчет

Разместите эту информацию об угрозах на своём сайте или в блоге

embed.html
<iframe
  src="https://phishdestroy.io/ru/embed/domain/ourbusinessloans.com"
  title="PhishDestroy threat report for ourbusinessloans.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>