Перейти к отчёту о безопасности
Безопасность домена и анализ угроз
yourlocfunding.com favicon

yourlocfunding.com

Вердикт по угрозе Критический 95/100 оценка доказательств
Доступность Непроверенный Текущая доступность не проверена
Всего обнаружений вирусов: 15/89 Сохраненные совпадения в черном списке: 1.
OTX: 12 refs 22.09.2026
Actions API
⚠️
Этот домен был отмечен как вредоносный
Механизмы безопасности сообщают об обнаружении: 15. Публичные черные списки, сообщающие о совпадении: 1. Будьте предельно осторожны — не вводите учетные данные или личную информацию.
Краткий обзор отчёта

yourlocfunding.com — Непроверенный. Сводка доказательств: VirusTotal 15/89 (alphaMountain.ai, BitDefender, Chong Lua Dao, CyRadar, ESET); URLScan capture; 1 external blocklist match (CryptoFirewall); PhishDestroy score 95/100. Регистратор: GoDaddy.

Подробный анализ PhishDestroy AI ниже оставлен на английском, чтобы сохранить исходную криминалистическую запись.

Сводка доказательств

КРИТИЧЕСКИЙ
Оценка
95/100

Assessment
Stored evidence for yourlocfunding.com: VirusTotal recorded 15 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for yourlocfunding.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 15 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for yourlocfunding.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains yourlocfunding.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed yourlocfunding.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2024-10-18. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 160.153.0.202 as the observed address in this record. The registration date for yourlocfunding.com is recorded as 2024-10-18. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The yourlocfunding.com record states that VirusTotal recorded 15 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 160.153.0.202. The supported conclusion is bounded to the exact stored observations for yourlocfunding.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to yourlocfunding.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain yourlocfunding.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to yourlocfunding.com. The stored record does not justify extending that rule to 160.153.0.202 or to other infrastructure records.

VirusTotal
VirusTotal
15 det.
OTX references
Возраст
1.9 yr
Зафиксированный статус
Непроверенный
PhishDestroy
DestroyList
В списке
Охват данных VirusTotal 15 / 89 OTX 12 community references URLScan capture сохраненный отчет TLS нет данных сертификата WHOIS 23 mo old Снимок экрана 3 captures · 2 sources

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as unknown pointing to IP 160.153.0.202.

Процесс реагирования на угрозы

Открытие
Checks
Reports
Доступность
10/12

Статус в публичных блок-листах

Анализ методов обнаружения и уклонения

Проверка маскировки и распределения трафика

Еще не отсканировано Пока не было зафиксировано никаких различий между роботом-пауком и браузером

Сохраненные данные сравнения данных сканера и браузера для данного хоста, а также проверка отпечатков в режиме реального времени для систем распределения трафика типа «Кейтаро».

Сохраненный флаг маскировки
Еще не отсканировано
Проверка отпечатков пальцев в режиме реального времени с помощью «TDS»
Семь отпечатков Keitaro, а также сравнение кроулера и браузера — запускаются со сканера PhishDestroy при открытии этой панели.
Ожидание

Сохранённый снимок · 3 sources

Аналитика доменов

Домен
OTX Tags activecampaignasciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsert+6 more
Регистратор GoDaddy US(US)
IP-адрес 160.153.0.202
Обратный поиск IPviewdns.info → rapiddns.io →
РегистрацияСоздано 18.10.2024 Expires 18.10.2026
Технические деталиDNS, SAN в протоколе SSL, временные метки
Впервые обнаружено22.09.2026
Submitted URLhttp://yourlocfunding.com/
Серверы имёнns65.domaincontrol.comns66.domaincontrol.com
Favicon Hash
Пожаловаться на этот домен Предоставьте доказательства и помогите защитить других

Анализ VirusTotal

15 / Поставщики средств безопасности 89 отметили этот домен
View on VT
Last analyzed
alphaMountain.ai
BitDefender
Chong Lua Dao
CyRadar
ESET
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
Lionic
SOCRadar
Sophos
Viettel Threat Intelligence
VIPRE
Webroot

Доказательства и внешние отчеты

Повлиял ли на вас этот сайт?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

Если вы ввели учетные данные, личную или платежную информацию или загрузили файл с этого домена, примите немедленные меры. Ниже приведены ресурсы, которые помогут вам сообщить об инциденте и защитить себя.

Европол
Найдите официальный канал отчетности для вашей страны ЕС
National police directory
Остерегайтесь мошенников, предлагающих услуги по восстановлению данных! Преступники могут снова связаться с жертвами, притворяясь следователями, адвокатами или агентами по восстановлению. Не платите авансовые платежи и не делитесь учетными данными. Узнайте больше о мошенничестве при получении компенсаций →

Сообщите об этом в местные органы власти

Выберите свою страну, чтобы получить официальные контакты по киберпреступности или создать проект жалобы →.

Каталог 97 стран
Черновик по шаблону • помощь AI с формулировками включается только с отдельного согласия. Просмотрите и отправьте его самостоятельно

Проверить любой домен

Анализ угроз с использованием сохраненного черного списка, WHOIS, DNS и общедоступных доказательств сканирования.

Сканировать сейчас

Сообщить о фишинге

Добавляйте подозрительные домены в нашу базу данных угроз — защищайте сообщество

Сообщить

Поток оперативных данных об угрозах

Недавние сообщения о фишинге и наблюдаемые изменения доступности

Отслеживать

Будьте в курсе событий, берегите себя

Отслеживайте актуальные угрозы или оспорьте эту запись, если считаете, что это ложное срабатывание

Поток оперативных данных об угрозах Подать жалобу на это объявление
HTML · IFRAME

Вставить этот отчет

Разместите эту информацию об угрозах на своём сайте или в блоге

embed.html
<iframe
  src="https://phishdestroy.io/ru/embed/domain/yourlocfunding.com"
  title="PhishDestroy threat report for yourlocfunding.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>