보안 보고서로 이동
⚠️
이 도메인은 악성 도메인으로 표시되었습니다.
탐지를 보고하는 보안 엔진: 18. 극도의 주의를 기울이십시오 — 자격 증명이나 개인 정보를 입력하지 마십시오.
도메인 보안 및 위협 인텔리전스

fhhhggrhrhrseriiivcevsercvicmsyp[.]weebly[.]com

“Telstra - Inbox - Mail - Webmail”

위협 평결 심각 95/100 증거 점수
가용성 콘텐츠를 사용할 수 없음 최근 관찰에서는 콘텐츠를 사용할 수 없었습니다.
VirusTotal 탐지: 18/93 브랜드 사칭: Telstra
2026년 1월 25일 Telstra CDN
보고서 요약

fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com — 콘텐츠를 사용할 수 없음. 브랜드 사칭: Telstra; 사기 유형: Brand Impersonation. 증거 요약: VirusTotal 18/93 (ADMINUSLabs, alphaMountain.ai, BitDefender, CyRadar, Ermes); URLScan malicious verdict; CF Radar malicious; PhishDestroy score 95/100. 등록기관: Squarespace Domains II.

원본 포렌식 기록을 보존하기 위해 아래의 상세 PhishDestroy AI 분석은 영어로 유지됩니다.

증거 요약
중요
참조
789BAD8B
점수
95/100

This domain is flagged for elevated-risk brand impersonation targeting Telstra, specifically designed to mimic the company’s webmail interface for credential harvesting. Analysis of the page title, Telstra - Inbox - Mail - Webmail, confirms the intent to deceive users into entering sensitive login details under the guise of a legitimate communication portal. The threat type is classified as credential phishing with a focus on corporate or personal email compromise, a tactic commonly used to facilitate further fraudulent activities such as unauthorized access, data exfiltration, or financial fraud. Infrastructure analysis reveals multiple technical indicators supporting the malicious classification. The domain was registered through Squarespace Domains II LLC on February 21, 2026, and currently resolves to the IP address 74.115.51.9, hosted on autonomous system AS27647 (Weebly, Inc.) in the United States. The SSL certificate is issued by Let’s Encrypt (serial E8), a common choice for both legitimate and malicious sites due to its free and automated issuance process. The domain appears on one security blocklist and is actively blocked by PhishDestroy. VirusTotal detection metrics show 18 out of 95 security vendors flagging the domain as malicious, with a focus on phishing-related threats. The combination of a recently created domain, low detection but targeted blocklisting, and hosting on a platform known for abuse underscores the calculated nature of this campaign. Mitigation steps should prioritize both technical and user-focused controls to disrupt the phishing operation and prevent credential compromise. Network-level blocking of the domain and its resolving IP (74.115.51.9) is recommended, along with monitoring for any attempts to access the domain from internal systems. Security teams should review logs for connections to the IP or domain, particularly from endpoints exhibiting anomalous behavior such as unexpected authentication attempts or data transfers. User awareness training should emphasize the risks of webmail impersonation, including the verification of domain authenticity and the use of multi-factor authentication (MFA) for all corporate and personal email accounts. Additionally, organizations should implement email filtering rules to quarantine or flag messages containing links to domains hosted on Weebly or other free website builders, as these platforms are frequently abused for phishing campaigns. Proactive monitoring for similar domains, particularly those using random character strings or slight variations of the target brand name, can help identify and neutralize emerging threats before they gain traction.

VirusTotal
VirusTotal
18 det.
CF 레이더
악성
URLScan
URLScan
TLS 인증서
만료되었거나 검증되지 않음 -100d
관측 상태
콘텐츠를 사용할 수 없음
PhishDestroy
DestroyList
등록됨
데이터 적용 범위 VirusTotal 18 / 93 URLQuery 보고서 저장됨 - 자세한 판결 보류 중 PhishStats checked — no match recorded OTX no community references CF 레이더 provider verdict: malicious URLScan capture 저장된 보고서 URLScan verdict malicious DNS 차단 확인되지 않음 TLS 만료되었거나 검증되지 않음 WHOIS not parsed 스크린샷 2 captures · 2 sources 리디렉션 체인 조사되지 않음
네트워크 보안 인텔리전스
CF Cloudflare Radar Verdict 악성
Phishing Security threats Phishing

위협 대응 Pipeline

발견
Checks
Reports
가용성
17/18

공개 차단 목록 상태

저장된 캡처

페이지 제목
Telstra - Inbox - Mail - Webmail
TLS 인증서
만료되었거나 검증되지 않음 · 발급자 Let's Encrypt / E8

도메인 인텔리전스

도메인
URLScan Verdict 악성 score 100 Phishing brand: Telstra report ↗
서버 / ASN cloudflare · AS27647 WEEBLY - Weebly, Inc., US
IP Context Cloudflare shared edge origin IP hidden Edge-IP 평판은 이 도메인에 귀속되지 않습니다.
Registrar (base domain) Squarespace Domains II US(US)
IP 주소 74.115.51.9 CDN
위치US Oakland, US
네트워크AS27647 · Weebly, Inc.
원본 IP는 CDN 프록시 뒤에 숨겨져 있습니다. 에지 주소에 대한 역방향 IP 결과에는 관련되지 않은 테넌트가 포함되어 있습니다. 원본을 찾으려면 수동 DNS 또는 인증서 투명성 데이터가 필요합니다.
Registration (base domain)weebly.com · Expires 2026년 3월 28일
최초 이용 불가까지 걸린 시간 34 days
집계 기준 처음 저장된 악용사례 신고부터 콘텐츠를 사용할 수 없다는 첫 번째 관찰까지의 경과 시간입니다. 이것은 원인을 확립하지 못합니다.
각 보고서에 포함된 내용 저장된 발신 보고서 기록은 공급업체 평가, 등록 데이터, 호스팅 세부 정보, 분류 또는 스크린샷과 같이 당시 사용 가능한 증거를 참조할 수 있습니다. 이 페이지는 전달된 정확한 페이로드, 수신, 확인 또는 수신자의 작업을 추론하지 않습니다.
기술적 세부 사항DNS, SSL SAN, 타임스탬프
최초 발견2026년 1월 25일
DOM Analysisanalyzed 2026년 7월 29일score 0/100
IoC Extractionscanned 2026년 8월 2일0 wallet · 0 Telegram IoCs
Submitted URLhttp://fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com/
네임서버ns-123.awsdns-15.comns-1500.awsdns-59.orgns-1797.awsdns-32.co.ukns-646.awsdns-16.net
TLS Fingerprint
TLS Observationvalid from 2026년 2월 12일scanned 2026년 3월 15일
TLS SAN Domainsweebly.com
Favicon Hash
ICANN OVERSIGHT Registration: weebly.com

인증 및 RAA 상황

Registrar accreditation and DNS abuse obligations

For the registrable domain weebly.com behind this subdomain, the registrar above operates under an ICANN accreditation agreement. The links below provide the official fee schedule and current DNS abuse compliance guidance.

Accreditation is a contract, not a safety certification.

RAA §3.18 establishes abuse-contact and handling requirements. This report can document stored outbound notices and later technical observations; it does not by itself establish receipt, investigation, remediation, or contractual non-compliance.

Accountability draft 어떤 내용도 자동으로 전송되지 않습니다.
사용 기술 · 1 identified
Cloudflare
CDN

Cloudflare is a web-infrastructure and website-security company, providing content-delivery-network services, DDoS mitigation, Internet security, and distributed domain-name-server services.

www.cloudflare.com 신뢰도 100%
Detected via Cloudflare Radar · Wappalyzer engine
이 도메인 신고하기 증거를 제출하고 다른 사람들을 보호하는 데 힘을 보태주세요

VirusTotal 분석

18 / 93 보안 공급업체가 이 도메인에 플래그를 지정했습니다.
View on VT
Last analyzed
ADMINUSLabs
alphaMountain.ai
BitDefender
CyRadar
Ermes
Emsisoft
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
카스퍼스키
Lionic
MalwareURL
넷크래프트
소포스
Trustwave
VIPRE
Webroot

보관된 증거

Wayback Machine Snapshot
증거 검토를 위해 과거 스냅샷을 사용할 수 있습니다.
View Archive

증거 및 외부 보고서

이 사이트로 인해 영향을 받으셨나요?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

계정 자격 증명, 개인 정보 또는 결제 정보를 입력했거나 이 도메인에서 파일을 다운로드한 경우 즉시 조치를 취하세요. 다음은 사건을 신고하고 자신을 보호하는 데 도움이 되는 리소스입니다.

유로폴
EU 국가의 공식 신고 채널 찾기
National police directory
회복 사기꾼들을 조심하세요! 범죄자는 수사관, 변호사, 회복요원인 척 하면서 피해자에게 다시 연락할 수도 있습니다. 선불 비용을 지불하거나 자격 증명을 공유하지 마십시오. 회복 관련 사기에 대해 자세히 알아보기 →

지역 당국에 신고하십시오

공식 사이버 범죄 연락처 또는 불만사항 초안 작성 →를 받으려면 국가를 선택하세요.

97개국 디렉토리
AI 지원 초안 - 사고 세부정보는 AI 제공업체에서 처리됩니다. 직접 검토하고 제출하세요.

모든 도메인 확인

저장된 차단 목록, WHOIS, DNS 및 공개 스캔 증거를 사용한 위협 분석

지금 스캔하기

피싱 신고

의심스러운 도메인을 당사의 위협 데이터베이스에 신고해 주세요 — 커뮤니티를 보호해 주세요

보고서

실시간 위협 정보

최근 피싱 보고서 및 관찰된 가용성 변경 사항

모니터링

최신 정보를 확인하고, 안전을 지키세요

실시간 위협을 모니터링하거나, 오탐이라고 판단될 경우 이 목록에 이의를 제기하십시오.

실시간 위협 정보 이 목록에 이의 제기하기
HTML · IFRAME

이 보고서 삽입하기

이 위협 정보를 귀하의 웹사이트나 블로그에 공유하세요

embed.html
<iframe
  src="https://phishdestroy.io/ko/embed/domain/fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com"
  title="PhishDestroy threat report for fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>

매우 진심 어린 감사 편지

풍자적 초안 생성기

수신자
수수료 맥락

풍자적 초안입니다. 수수료 수치는 추정치이며, 이 도메인에 정확히 귀속된다고 주장하지 않습니다.