⚠️
This domain has been flagged as malicious
Detected by 13 security vendors and listed in 1 public blocklist. Exercise extreme caution — do not enter personal information or connect wallets. Generate an official AI-powered complaint letter to file with cybercrime authorities.
pancakeswapcakepad.finance favicon

pancakeswapcakepad[.]finance

Domain Security & Threat Intelligence Report

“CAKE PAD”

13/95 VT URLQuery: 100 Content unavailable Nov 20, 2025 Unavailable since May 14, 2026 1 Blocklist PancakeSwap Wallet Connect Abuse Wallet/Seed Phishing 1 Report Sent 175d to unavailable FR FR Wallet Connect + more
15 Risk Score
PhishDestroy AI
HIGH
Ref
EDA728EB
Score
15/100
Engine
PD-4 Turbo
The domain pancakeswapcakepad[.]finance, impersonating PancakeSwap, has a critical threat score of 15/100 and is currently down. It has been flagged as malicious by 13 out of 95 security vendors, including BitDefender and Sophos, and is listed on 2 public blocklists. Google Safe Browsing has not flagged this domain, but it is associated with Wallet Connect abuse, indicating a potential crypto scam.

Registered with OVH, the domain's hosting IP is 51.77.169.44. It was first seen on 2025-11-20. The site has been taken down, but the presence of multiple detections and blocklist entries suggests it was actively used for phishing or scamming purposes. Block the domain at the perimeter and submit a report to the registrar's abuse desk.
VirusTotal
VirusTotal
13 det.
URLQuery
URLQuery
100 det.
URLScan
URLScan
Gridinsoft
0/100
Observed status
Content unavailable
PhishDestroy
DestroyList
Listed
Reports Sent
1
Data coverage VirusTotal 13 / 95 URLQuery 100 det. OTX no pulses CF Radar clean URLScan report ready DNS blocks none SSL no cert WHOIS not parsed Screenshot not captured Redirect chain not probed Gridinsoft 0/100

Threat Response Pipeline

Discovery
Checks
Reports
Availability
14/14
Pre-emptive Discovery & Ingestion
Threat Ingested
1/1 ✓
Threat Ingested
pancakeswapcakepad.finance detected and queued for full analysis
Nov 20, 2025
Threat Intelligence Checks
URLScan.io Snapshot · Cloudflare Radar · VirusTotal · Google Safe Browsing · Blocklist Detection · Drainer Identified · Forensic Evidence Collected · Technical Analysis Recorded · Cloudflare Radar Scan
9/9 ✓
URLScan.io Snapshot
Submitted to urlscan.io — screenshot, DOM & HTTP transactions captured
Feb 28, 2026
Cloudflare Radar
Scanned via Cloudflare Radar — DNS, certificates & network data
VirusTotal
13 / 95 vendors flagged on VirusTotal
May 15, 2026
Google Safe Browsing
Mar 03, 2026
Blocklist Detection
Found in 1 blocklist: ScamSniffer
Jul 21, 2026
Drainer Identified
Wallet Connect Abuse wallet drainer — impersonating PancakeSwap
Forensic Evidence Collected
Stored evidence from URLScan.io, stored screenshot
Feb 28, 2026
Technical Analysis Recorded
The report contains stored technology or forensic-analysis results
Jul 21, 2026
Cloudflare Radar Scan
Scanned via Cloudflare Radar — network analysis completed
Mar 07, 2026
Notification Records
Abuse Reports Sent
1/1 ✓
Abuse Reports Sent
Abuse report sent to registrar OVH_314827644 (ASN: 16276), hosting provider, 2 abuse contacts
Nov 20, 2025
Publication & Availability
DestroyList Published · Content Observed Unavailable · Time to First Unavailability
3/3 ✓
DestroyList Published
Nov 20, 2025
Content Observed Unavailable
The latest stored checks indicate that the reported content is unavailable; this does not establish who or what caused the change
May 14, 2026
Time to First Unavailability
4199 hours elapsed from detection to the first unavailable observation

Public Blocklist Status

2
Confirmed in 2 datasets: PhishDestroy + 1 independent public blocklist — ScamSniffer
10 external threat databases checked; 1 matched. Last synchronized Jul 21, 2026. PhishDestroy database match: confirmed.

Evidence Capture

Live Snapshot
2025-11-20 06:16 UTC
Malicious · 13/95 engines
Forensic screenshot of pancakeswapcakepad.finance showing the phishing page layout
IP: 51.77.169.44
OVH_314827644 (ASN: 16276)
Page Title
CAKE PAD
Impersonates
Bnb Chain Pancakeswap

Domain Intelligence

Domainpancakeswapcakepad.finance
Registrar OVH_314827644 (ASN: 16… FR(FR)
IP Address 51.77.169.44 FR
GeoFR Lille, FR
NetworkASAS16276 · AS16276 OVH SAS
Time to First Unavailability 175 days
What we count Elapsed time from the first stored abuse report to the first observation that pancakeswapcakepad.finance was unavailable. This does not establish the cause.
What each report contains Stored outgoing report records may reference evidence available at the time, such as vendor verdicts, registration data, hosting details, classifications, or screenshots. This page does not infer the exact payload delivered, receipt, acknowledgement, or action by a recipient.
Technical detailsDNS, SSL SANs, timestamps
First DetectedNov 20, 2025
Nameserversns1.regery.netns2.regery.netns3.regery.net
Technologies · 1 identified
jsDelivr
CDN

Free public CDN for open-source projects, serving files from npm and GitHub.

Detected via Cloudflare Radar · Wappalyzer engine
Report This Domain Submit evidence & help protect others

VirusTotal Analysis

13 / 95 security vendors flagged this domain
View on VT
alphaMountain.ai
BitDefender
CRDF
CyRadar
Ermes
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
Lionic
SOCRadar
Sophos
Webroot

Evidence & External Reports

Were You Affected by This Site?

You are not alone and there is nothing to be ashamed of. Scammers are sophisticated criminals who exploit trust. Reporting your experience is the most powerful weapon against fraud — your report can prevent others from becoming victims and help law enforcement take action. Silence is the scammer's greatest advantage. Break it.

If you have interacted with this domain, entered personal information, or connected a cryptocurrency wallet — take immediate action. Below are resources to help you report the incident and protect yourself.

Beware of recovery scammers! After being scammed, criminals may contact you again pretending to be "recovery agents," lawyers, or investigators who claim they can retrieve your lost funds — for a fee. This is a second scam. No legitimate service will ask for upfront payment to recover stolen crypto. Learn more about recovery fraud →

Report to Your Local Authorities

Select your country to get official cybercrime contacts, or generate an AI-powered complaint →

Select your country...
180+ countries
Zero-PII — your data never leaves the browser AI writes in your language

Related Domain Reports

97ee8.catex.at
97ee8.catex.at
18 detections
litsurprise.com
litsurprise.com
4 detections
cuentacorriente.com.co
cuentacorriente.com.co
7 detections
saranbet374.com
saranbet374.com
5 detections
haithamgomaa.com
haithamgomaa.com
4 detections
sajitoto4d.cyou
sajitoto4d.cyou
6 detections

Other Domains on 51.77.169.44 3 phishing domains

This IP hosts multiple phishing domains — infrastructure shared across campaigns

ath.fail favicon ath.fail 6/95 ifumbled.cash favicon ifumbled.cash 5/95 chian.link favicon chian.link 5/95

Other PancakeSwap Impersonation Domains

These domains also target PancakeSwap users. View all PancakeSwap threats →

event-pancakeswap.app event-pancakeswap.app 22 claim-pancake.app claim-pancake.app 21 pancacke.com pancacke.com 21 pancake-swap-finance.com pancake-swap-finance.com 21 pancakewebv3.app pancakewebv3.app 21 mail.hex.arhamsoft.info mail.hex.arhamsoft.info 20 pancakeswap2sj.pages.dev pancakeswap2sj.pages.dev 20 puncake-svvap.web-3.to puncake-svvap.web-3.to 20

About This Report: pancakeswapcakepad.finance

This report presents the latest stored evidence available to PhishDestroy. Source timestamps are shown where available; availability and vendor verdicts can change after collection.

The site displays a page titled “CAKE PAD”, which may be designed to impersonate PancakeSwap.

pancakeswapcakepad.finance has been flagged by 13 security vendors as of July 21, 2026. This site has been identified as a Wallet Connect Abuse.

If you believe this listing is inaccurate, you can submit an appeal. For more information about our methodology, visit our FAQ page.

Check Any Domain

Threat analysis using stored blocklist, WHOIS, DNS, and public scan evidence

Scan Now

Report Phishing

Submit suspicious domains to our threat database — protect the community

Report

Live Threat Feed

Recent phishing reports and observed availability changes

Monitor

Stay Informed, Stay Safe

Monitor live threats or contest this listing if you believe it's a false positive

Live Threat Feed Appeal This Listing

Recommendations & Advice for Victims

An estimated $51 billion flowed to illicit crypto wallets in 2024 (source). If you interacted with pancakeswapcakepad.finance — act now.

What should I do immediately?
Urgent
  • Revoke token approvals — use revoke.cash to remove access granted to malicious smart contracts
  • Move remaining funds to a brand-new wallet. The compromised wallet is no longer safe
  • Change all passwords — email, exchange accounts, anything that shares the same password
  • Enable 2FA using an authenticator app (not SMS). Disable SMS-based recovery
  • Freeze cards if you entered banking details on the phishing site
What information should I collect for my report?
FBI guidelines

According to the FBI, the most important details are transaction data:

  • Cryptocurrency addresses — scammer's wallet (e.g., 0x5856...35985)
  • Amount & crypto type — exact amount (e.g., 1.02345 ETH, 0.5 BTC, 500 USDT)
  • Transaction ID (hash) — the unique blockchain transaction identifier
  • Exact dates & times — of each transaction and first contact with scammer
  • Screenshots — scam website, chat messages, emails, wallet transactions, social media
  • All URLs & domains used by the scammer (including pancakeswapcakepad.finance)
  • Communications — emails, texts, phone numbers, usernames the scammer used

Even if you don't have all details — file a report anyway. Partial information still helps investigations.

Where should I report the scam?
  • FBI IC3 — Internet Crime Complaint Center (US federal reporting)
  • Europol — European cybercrime reporting (EU)
  • Chainabuse — flag scam wallets across exchanges & platforms
  • Your crypto exchange — contact Coinbase/Binance/Kraken support to freeze scammer's address
  • Local police — creates an official record, even if they can't act immediately

The FBI recovered over $1 billion in crypto fraud in 2024 thanks to victim reports. Your report matters.

How do crypto scams typically work?
  • Fake websites — pixel-perfect clones of legitimate sites with slightly altered domains
  • Malicious approvals — "connect wallet" prompts that grant unlimited token spending to attackers
  • Pig butchering — trust built over weeks via Telegram/WhatsApp/dating apps, then money stolen
  • Recovery scams — victims targeted AGAIN by fake "recovery agents" demanding upfront fees. Always a scam
  • Fake ads & airdrops — Google/social media ads and "free token" offers leading to wallet drainers
  • AI-powered scams — deepfakes, automated phishing, and AI-generated sites making fraud harder to detect
How can I protect myself in the future?
  • Use a hardware wallet (Ledger, Trezor). Never store large amounts in browser wallets
  • Bookmark official sites — never click links from emails, DMs, or ads
  • Read every approval — verify permissions before signing. Reject unlimited approvals
  • Verify domains — check on PhishDestroy before interacting. Check HTTPS, spelling, domain age
  • "Too good to be true" = scam — guaranteed returns, celebrity endorsements, urgent deadlines
How big is the crypto scam problem?
  • $51 billion flowed to illicit crypto wallets in 2024 — CoinLedger
  • Pig butchering losses grew 40% year over year, now the fastest-growing fraud type
  • Only ~5% of victims report — your report helps shut down criminal networks
  • FBI recovered $1B+ in 2024 thanks to victim reports — FBI.gov

Sources: FBI · CoinLedger · WorldMetrics

Embed This Report

Share this threat intelligence on your website or blog