⚠️
This domain has been flagged as malicious
Detected by 13 security vendors and listed in 2 public blocklists. Exercise extreme caution — do not enter personal information or connect wallets.
pancakeswapcakepad.finance favicon

pancakeswapcakepad[.]finance

Domain Security & Threat Intelligence Report

“CAKE PAD”

13/13 VT URLQuery: 100 Active threat Nov 20, 2025 2 Blocklists PancakeSwap Wallet Connect Abuse ["wallet Connect Phish"] 1 Report Sent FR FR Wallet Connect + more
13/13 VT vendors 2 blocklists Targets PancakeSwap
15 Risk Score
PhishDestroy AI
HIGH
Ref
EDA728EB
Score
15/100
Engine
PD-4 Turbo
PhishDestroy identifies pancakeswapcakepad[.]finance as a high-risk crypto drainer impersonating the PancakeSwap brand. The domain uses Wallet Connect abuse techniques to steal user funds.

This domain resolves to IP 51.77.169.44 and is registered via OVH under ASN 16276. It is flagged by 13 security vendors and appears on 4 blocklists, indicating its malicious nature and widespread detection.

Currently offline, pancakeswapcakepad[.]finance no longer poses an active threat. Users are advised to avoid any interaction with it and verify URLs carefully to prevent wallet compromise.
VT
VirusTotal
13 det.
UQ
URLQuery
100 det.
US
URLScan
Gridinsoft
0/100
Status
Live 530
PD
DestroyList
Listed
Reports Sent
1
Data coverage VirusTotal 13 / 13 URLQuery 100 det. OTX no pulses CF Radar clean URLScan report ready DNS blocks none SSL no cert WHOIS not parsed Screenshot not captured Redirect chain blocked_private_ip CDN bypass DNS suspended, no bypass Gridinsoft 0/100

Threat Response Pipeline

Discovery
Submission
Legal
Takedown
21/22
Pre-emptive Discovery & Ingestion
30+ Proprietary Parsers · Infrastructure Analysis · Community Intelligence · Threat Ingested
4/4 ✓
30+ Proprietary Parsers
Distributed network scanning Google Ads (malvertising), SEO-manipulated results, Twitter/X, YouTube & Telegram campaigns
Infrastructure Analysis
dnstwist & typosquatting detection to catch look-alike domains targeting established brands
Community Intelligence
Real-time ingestion of community-reported threats via Telegram Bot & partner intelligence feeds
Threat Ingested
pancakeswapcakepad.finance detected and queued for full analysis
Nov 20, 2025
Global Ecosystem Submission
54+ Vendor Submissions · URLScan.io Snapshot · Cloudflare Radar · VirusTotal · Google Safe Browsing · Blocklist Detection · Drainer Identified · Forensic Evidence Collection · Web Archive Preservation · Technical Deep Analysis · Cloudflare Radar Scan
11/11 ✓
54+ Vendor Submissions
Threat data submitted to 54+ security vendors & threat intelligence platforms
Show all 54 vendors
SpamhausCloudflareGoogle Safe BrowsingMicrosoft SecurityVirusTotalNetcraftESETBitdefenderNorton Safe WebAviraPhishTankDr.WebYandex Safe BrowsingURLScan.ioPolySwarmSiteReviewURLQueryPhishStatsPhishReportIsItPhishThreatCenterKasperskyOpenPhishAPWG eCrimeComodo / XcitiumFortinet / FortiGuardPalo Alto NetworksSophosTrend MicroWebrootZeroFOXSURBLAbusixCRDF LabsQuad9CleanBrowsingCyRadarScumware.orgPhishing.DatabaseMalware PatrolANY.RUNHybrid AnalysisURLhausMalwareBazaarThreatFoxAbuse.chAbuseIPDBAlienVault OTXMISPDomainToolsSecurityTrailsCensysBinaryEdgeCIRCL
URLScan.io Snapshot
Submitted to urlscan.io — screenshot, DOM & HTTP transactions captured
Feb 28, 2026
Cloudflare Radar
Scanned via Cloudflare Radar — DNS, certificates & network data
VirusTotal
13 / 13 vendors flagged on VirusTotal
May 15, 2026
Google Safe Browsing
Mar 03, 2026
Blocklist Detection
Found in 2 blocklists: ScamSniffer, PhishDestroy
Jun 02, 2026
Drainer Identified
Wallet Connect Abuse wallet drainer — impersonating PancakeSwap
Forensic Evidence Collection
Public scans via URLScan.io, URLQuery & Cloudflare Radar — DOM snapshots, HTTP transactions, DNS & certificate data
Web Archive Preservation
Site preserved in Wayback Machine — immutable copy of phishing content for legal evidence
Technical Deep Analysis
JS source analysis, directory enumeration, open directories scan, email harvesting, Telegram bot detection, exposed databases & other OSINT artifacts useful for threat actor identification
Cloudflare Radar Scan
Scanned via Cloudflare Radar — network analysis completed
Mar 07, 2026
Legal Notifications & Reporting
Registrar & Hosting Notification · DestroyList Published · Abuse Reports Sent · Conditional Re-detection
4/4 ✓
Registrar & Hosting Notification
Initial abuse reports sent to domain registrar (OVH_314827644 (ASN: 16276)) and hosting provider with forensic evidence packages (metadata, screenshots, PDF)
DestroyList Published
Added to PhishDestroy/DestroyList — open-source blocklist for wallets & extensions
Nov 20, 2025
Abuse Reports Sent
Abuse report sent to registrar OVH_314827644 (ASN: 16276), hosting provider, 2 abuse contacts
Nov 20, 2025
Conditional Re-detection
Follow-up alerts only if threat remains active beyond 24 hours — prevents spam, ensures reports contain active evidence
ICANN Escalation — triggered only on re-detection (24h+ active threat), not on initial report. Formal complaint per RAA §3.18 with full forensic evidence
Public Transparency & Takedown
Open Threat Database · Social Broadcasting · Awaiting Takedown
2/3
Open Threat Database
Real-time commits to GitHub repository & live monitoring at phishdestroy.io/live
Social Broadcasting
Automated alerts on Twitter, Telegram & Mastodon channels
Awaiting Takedown
Domain still active — monitoring & re-reporting continues

Public Blocklist Status

Evidence Capture

Live Snapshot
2025-11-20 06:16 UTC
Malicious · 13/13 engines
Forensic screenshot of pancakeswapcakepad.finance showing the phishing page layout
IP: 51.77.169.44
OVH_314827644 (ASN: 16276)
Page Title
CAKE PAD
Impersonates
Bnb Chain Pancakeswap

Domain Intelligence

Domainpancakeswapcakepad.finance
Registrar OVH_314827644 (ASN: 16… FR(FR)
IP Address 51.77.169.44 FR
GeoFR Lille, FR
NetworkASAS16276 · AS16276 OVH SAS
HTTP Status530 Error
Days Ignored 175 days still online
What we count Elapsed time from the first abuse report we filed to the registrar — domain remains online and the registrar has taken no confirmed action. This is raw elapsed time, not active-response-pending.
What each report contains Every report delivered to OVH_314827644 (ASN: 16276) includes the full forensic bundle we have on file — VirusTotal verdict, URLScan snapshot, WHOIS, SSL metadata, IP & hosting chain, impersonated-brand evidence, drainer / kit classification if applicable, screenshots, and a cryptographic hash of the forensic PDF. The e-mail explicitly requests the registrar to review the client against their acceptable-use policy and take action under ICANN RAA §3.18.
HTTP Status530
Technical detailsDNS, SSL SANs, timestamps
First DetectedNov 20, 2025
Nameserversns1.regery.netns2.regery.netns3.regery.net
Technologies · 1 identified
jsDelivr
CDN

Free public CDN for open-source projects, serving files from npm and GitHub.

Detected via Cloudflare Radar · Wappalyzer engine
Report This Domain Submit evidence & help protect others

VirusTotal Analysis

13 / 13 security vendors flagged this domain
View on VT
alphaMountain.ai
BitDefender
CRDF
CyRadar
Ermes
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
Lionic
SOCRadar
Sophos
Webroot

Evidence & External Reports

Were You Affected by This Site?

You are not alone and there is nothing to be ashamed of. Scammers are sophisticated criminals who exploit trust. Reporting your experience is the most powerful weapon against fraud — your report can prevent others from becoming victims and help law enforcement take action. Silence is the scammer's greatest advantage. Break it.

If you have interacted with this domain, entered personal information, or connected a cryptocurrency wallet — take immediate action. Below are resources to help you report the incident and protect yourself.

Beware of recovery scammers! After being scammed, criminals may contact you again pretending to be "recovery agents," lawyers, or investigators who claim they can retrieve your lost funds — for a fee. This is a second scam. No legitimate service will ask for upfront payment to recover stolen crypto. Learn more about recovery fraud →

Report to Your Local Authorities

Select your country to get official cybercrime contacts, or generate an AI-powered complaint →

Select your country...
180+ countries
Zero-PII — your data never leaves the browser AI writes in your language

Related Domain Reports

play.teacex.com
play.teacex.com
13 detections
deezbet.com
deezbet.com
15 detections
uniplaycassino.com
uniplaycassino.com
13 detections
winslots.cc
winslots.cc
15 detections
buterbet.com
buterbet.com
11 detections
jpwau.com
jpwau.com
14 detections

Other Domains on 51.77.169.44 3 phishing domains

This IP hosts multiple phishing domains — infrastructure shared across campaigns

ath.fail favicon ath.fail 6/95 ifumbled.cash favicon ifumbled.cash 5/95 chian.link favicon chian.link 5/95

Other PancakeSwap Impersonation Domains

These domains also target PancakeSwap users. View all PancakeSwap threats →

event-pancakeswap.app event-pancakeswap.app 22 claim-pancake.app claim-pancake.app 21 pancacke.com pancacke.com 21 pancake-swap-finance.com pancake-swap-finance.com 21 pancakewebv3.app pancakewebv3.app 21 mail.hex.arhamsoft.info mail.hex.arhamsoft.info 20 puncake-svvap.web-3.to puncake-svvap.web-3.to 20 pancakeswap-finance.fr pancakeswap-finance.fr 19

About This Report: pancakeswapcakepad.finance

This domain security report for pancakeswapcakepad.finance is maintained by PhishDestroy's automated threat intelligence pipeline. Our system continuously monitors this domain across 13 security vendors on VirusTotal, 2 public blocklists, URLScan.io.

The site displays a page titled “CAKE PAD”, which may be designed to impersonate PancakeSwap.

pancakeswapcakepad.finance has been flagged by 13 security vendors as of June 6, 2026. This site has been identified as a Wallet Connect Abuse.

If you believe this listing is inaccurate, you can submit an appeal. For more information about our methodology, visit our FAQ page.

Check Any Domain

Instant threat analysis with 50+ security engines, AI classification & forensic evidence

Scan Now

Report Phishing

Submit suspicious domains to our threat database — protect the community

Report

Live Threat Feed

Real-time monitoring of active phishing campaigns & takedown progress

Monitor

Stay Informed, Stay Safe

Monitor live threats or contest this listing if you believe it's a false positive

Live Threat Feed Appeal This Listing

Recommendations & Advice for Victims

An estimated $51 billion flowed to illicit crypto wallets in 2024 (source). If you interacted with pancakeswapcakepad.finance — act now.

What should I do immediately?
Urgent
  • Revoke token approvals — use revoke.cash to remove access granted to malicious smart contracts
  • Move remaining funds to a brand-new wallet. The compromised wallet is no longer safe
  • Change all passwords — email, exchange accounts, anything that shares the same password
  • Enable 2FA using an authenticator app (not SMS). Disable SMS-based recovery
  • Freeze cards if you entered banking details on the phishing site
What information should I collect for my report?
FBI guidelines

According to the FBI, the most important details are transaction data:

  • Cryptocurrency addresses — scammer's wallet (e.g., 0x5856...35985)
  • Amount & crypto type — exact amount (e.g., 1.02345 ETH, 0.5 BTC, 500 USDT)
  • Transaction ID (hash) — the unique blockchain transaction identifier
  • Exact dates & times — of each transaction and first contact with scammer
  • Screenshots — scam website, chat messages, emails, wallet transactions, social media
  • All URLs & domains used by the scammer (including pancakeswapcakepad.finance)
  • Communications — emails, texts, phone numbers, usernames the scammer used

Even if you don't have all details — file a report anyway. Partial information still helps investigations.

Where should I report the scam?
  • FBI IC3 — Internet Crime Complaint Center (US federal reporting)
  • Europol — European cybercrime reporting (EU)
  • Chainabuse — flag scam wallets across exchanges & platforms
  • Your crypto exchange — contact Coinbase/Binance/Kraken support to freeze scammer's address
  • Local police — creates an official record, even if they can't act immediately

The FBI recovered over $1 billion in crypto fraud in 2024 thanks to victim reports. Your report matters.

How do crypto scams typically work?
  • Fake websites — pixel-perfect clones of legitimate sites with slightly altered domains
  • Malicious approvals — "connect wallet" prompts that grant unlimited token spending to attackers
  • Pig butchering — trust built over weeks via Telegram/WhatsApp/dating apps, then money stolen
  • Recovery scams — victims targeted AGAIN by fake "recovery agents" demanding upfront fees. Always a scam
  • Fake ads & airdrops — Google/social media ads and "free token" offers leading to wallet drainers
  • AI-powered scams — deepfakes, automated phishing, and AI-generated sites making fraud harder to detect
How can I protect myself in the future?
  • Use a hardware wallet (Ledger, Trezor). Never store large amounts in browser wallets
  • Bookmark official sites — never click links from emails, DMs, or ads
  • Read every approval — verify permissions before signing. Reject unlimited approvals
  • Verify domains — check on PhishDestroy before interacting. Check HTTPS, spelling, domain age
  • "Too good to be true" = scam — guaranteed returns, celebrity endorsements, urgent deadlines
How big is the crypto scam problem?
  • $51 billion flowed to illicit crypto wallets in 2024 — CoinLedger
  • Pig butchering losses grew 40% year over year, now the fastest-growing fraud type
  • Only ~5% of victims report — your report helps shut down criminal networks
  • FBI recovered $1B+ in 2024 thanks to victim reports — FBI.gov

Sources: FBI · CoinLedger · WorldMetrics

Embed This Report

Share this threat intelligence on your website or blog