Güvenlik raporuna geç
Etki alanı güvenliği ve tehdit istihbaratı
digitalrushcapital.com favicon

digitalrushcapital.com

“Digital Rush Capital”

Tehdit kararı Kritik 100/100 kanıt puanı
Kullanılabilirlik Bilinen son aktif En son saklanan erişilebilirlik gözlemi
VirusTotal algılamaları: 12/89 Saklanan engelleme listesi eşleşmeleri: 1 Marka kimliğine bürünme: Unknown Bilinen son aktif
OTX: 10 refs 22.09.2026 Bilinmiyor 1 Report Sent CDN
Actions API
⚠️
Bu alan adı, zararlı olarak işaretlenmiştir
Güvenlik motorları bir algılama bildiriyor: 12. Bir eşleşme bildiren genel engellenenler listeleri: 1. Çok dikkatli olun — kimlik bilgilerini veya kişisel bilgileri girmeyin.
Rapor özeti

digitalrushcapital.com — Bilinen son aktif (HTTP 200). Marka kimliğine bürünme: Unknown. Kanıt özeti: VirusTotal 12/89 (alphaMountain.ai, BitDefender, Chong Lua Dao, CyRadar, Forcepoint ThreatSeeker); URLQuery 3 det.; URLScan capture; 1 external blocklist match (CryptoFirewall); PhishDestroy score 100/100. Kayıt kuruluşu: GoDaddy.

Özgün adli kaydı korumak için aşağıdaki ayrıntılı PhishDestroy AI analizi İngilizce bırakılmıştır.

Kanıt özeti

KRİTİK
Puan
100/100

Assessment
Stored evidence for digitalrushcapital.com: VirusTotal recorded 12 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for digitalrushcapital.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 12 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for digitalrushcapital.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains digitalrushcapital.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed digitalrushcapital.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2025-04-07. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 160.153.0.6 as the observed address in this record. The registration date for digitalrushcapital.com is recorded as 2025-04-07. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The digitalrushcapital.com record states that VirusTotal recorded 12 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 160.153.0.6. The supported conclusion is bounded to the exact stored observations for digitalrushcapital.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to digitalrushcapital.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain digitalrushcapital.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to digitalrushcapital.com. The stored record does not justify extending that rule to 160.153.0.6 or to other infrastructure records.

VirusTotal
VirusTotal
12 det.
URLQuery
URLQuery
3 det.
OTX references
URLScan
URLScan
TLS sertifikası
Google Trust Services / WE1
Yaş
1.5 yr
Gözlemlenen durum
Bilinen son aktif 200
PhishDestroy
DestroyList
Listelenmiş
Reports Sent
1
Veri kapsamı VirusTotal 12 / 89 URLQuery 3 det. OTX 10 community references CF Radarı scan completed URLScan capture saklanan rapor TLS valid certificate, 51d WHOIS 18 mo old Ekran görüntüsü 3 captures · 2 sources

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as unknown pointing to IP 160.153.0.6.

Tehdit Müdahale Pipeline

Keşif
Checks
Reports
Erişilebilirlik
12/13
Sent Report Recorded
Stored sent-report record for registrar GoDaddy.com, LLC, hosting provider, 1 abuse contact
abuse@godaddy.com
22.09.2026

Genel Engelleme Listesi Durumu

Tespit ve kaçınma analizi

Gizleme ve trafik dağıtımı kontrolü

Henüz taranmadı Henüz tarayıcı ile tarayıcı arası bir fark kaydedilmemiştir

Bu ana bilgisayar için saklanmış tarayıcı-karşı-tarayıcı gözlemleri ile Keitaro tarzı trafik dağıtım sistemleri için gerçek zamanlı parmak izi kontrolü.

Kaydedilmiş gizleme bayrağı
Henüz taranmadı
Son gizleme taraması
Tarayıcı tarafından algılanan sunucu başlığı
cloudflare

Tarayıcı notu: alive_content: raw=ok; http=200; via=https_proxy; server=cloudflare

TDS'da canlı parmak izi kontrolü
Bu panel açıkken, PhishDestroy tarayıcısından çalıştırıldığında yedi Keitaro parmak izi ve bir tarayıcı-crawler karşılaştırması görüntülenir.
Bekleme

Kaydedilen görüntü · 3 sources

Etki Alanı Analizi

Alan adı
Sunucu / ASN AS209242 Cloudflare London, LLC
IP Context Cloudflare shared edge origin IP hidden Edge-IP itibarı bu etki alanıyla ilişkilendirilmez.
OTX Tags asciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsertinvisible characters+6 more
Kayıt kuruluşu GoDaddy US(US)
IP adresi 160.153.0.6 CDN
Coğrafi konumUS Tempe, US
AS209242 · GoDaddy.com, LLC
Kaynak IP, bir CDN proxy'sinin arkasına gizlenir. Uç adresine ilişkin Ters IP sonuçları ilgisiz kiracılar içerir; Kaynağı bulmak için pasif DNS veya sertifika şeffaflığı verileri gerekir.
KayıtOluşturuldu 07.04.2025 Expires 07.04.2027
HTTP Durumu200
Teknik ayrıntılarDNS, SSL SAN’ları, zaman damgaları
İlk Kez Tespit Edildi22.09.2026
Submitted URLhttp://digitalrushcapital.com/
Ad sunucularıns31.domaincontrol.comns32.domaincontrol.com
MX Records1 aspmx.l.google.com 5 alt2.aspmx.l.google.com 5 alt1.aspmx.l.google.com 10 alt4.aspmx.l.google.com 10 alt3.aspmx.l.google.com
TLS Fingerprint
TLS Observationvalid from 15.08.2026scanned 23.09.2026
Favicon Hash
Vaka kimliği
Sayfa başlığı
Digital Rush Capital
TLS sertifikası
Valid transport encryption · Düzenleyen Google Trust Services / WE1 · valid for 51 days
Teknolojiler · 9 identified
Detected via Cloudflare Radar · Wappalyzer engine
Bu Alan Adını Bildir Kanıt sunun ve başkalarını korumaya yardımcı olun

VirusTotal Analizi

12 / 89 güvenlik sağlayıcıları bu alanı işaretledi
View on VT
Last analyzed
alphaMountain.ai
BitDefender
Chong Lua Dao
CyRadar
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
Lionic
SOCRadar
Sophos
Viettel Threat Intelligence

Kanıtlar ve Dış Raporlar

Gönderilen kanıt anlık görüntüsü
Sent: Ledger records: 1 Case ID: PD-20260922-102833 Recipient: abuse@godaddy.com
Page title stored with report: Digital Rush Capital
URLScan evidence VirusTotal evidence URLQuery evidence Screenshot 297.2 KB
PDF notice generated Notice text archived (650 chars)
Abuse notice text as sent to the provider
Policy Violations:
Illegal Activities: Active phishing operation targeting victims
Fraud & Deception: Impersonation of legitimate services
Identity Theft: Collection of credentials under false pretenses
Applicable Laws (Unknown):
International Anti-Cybercrime Regulations
Budapest Convention on Cybercrime
Universal Fraud Prevention Laws
Phishing activities violate international cybercrime conventions and Unknown's domestic fraud laws.
Action Required: This evidence-backed report demonstrates clear violations requiring suspension per your policies. Continued hosting exposes your organization to regulatory scrutiny and potential legal liability.

Bu Siteden Etkilendiniz mi?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

Hesap kimlik bilgilerini, kişisel bilgileri veya ödeme bilgilerini girdiyseniz ya da bu alan adından bir dosya indirdiyseniz hemen harekete geçin. Aşağıda olayı bildirmenize ve kendinizi korumanıza yardımcı olacak kaynaklar bulunmaktadır.

Europol
AB ülkeniz için resmi raporlama kanalını bulun
National police directory
Kurtarma dolandırıcılarına dikkat edin! Suçlular, araştırmacı, avukat veya kurtarma görevlisi gibi davranarak mağdurlarla tekrar iletişime geçebilir. Peşin ücret ödemeyin veya kimlik bilgilerinizi paylaşmayın. Geri ödeme dolandırıcılığı hakkında daha fazla bilgi edinin →

Yerel Yetkililere Bildirin

resmi siber suç iletişim bilgileri veya şikayet taslağı oluştur → almak için ülkenizi seçin.

97 ülke rehberi
Yapay zeka destekli taslak — olay ayrıntıları yapay zeka sağlayıcısı tarafından işlenir Kendiniz inceleyin ve gönderin

Herhangi Bir Alan Adını Kontrol Et

Saklanan engelleme listesi, WHOIS, DNS ve genel tarama kanıtlarını kullanarak tehdit analizi

Şimdi Tara

Oltalama Olayını Bildir

Şüpheli alan adlarını tehdit veritabanımıza bildirin — topluluğu koruyun

Bildir

Canlı Tehdit Akışı

Son kimlik avı raporları ve gözlemlenen kullanılabilirlik değişiklikleri

İzle

Gelişmelerden Haberdar Olun, Güvende Kalın

Canlı tehditleri izleyin veya bunun yanlış bir uyarı olduğunu düşünüyorsanız bu kayda itiraz edin

Canlı Tehdit Akışı Bu İlanı İtiraz Et
HTML · IFRAME

Bu Raporu Yerleştir

Bu tehdit bilgisini web sitenizde veya blogunuzda paylaşın

embed.html
<iframe
  src="https://phishdestroy.io/tr/embed/domain/digitalrushcapital.com"
  title="PhishDestroy threat report for digitalrushcapital.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>