Ir para o relatório de segurança
Segurança de domínio e inteligência contra ameaças
digitalrushcapital.com favicon

digitalrushcapital.com

“Digital Rush Capital”

Veredicto de ameaça Crítico Pontuação de evidência 100/100
Disponibilidade Último ativo conhecido Última observação de acessibilidade armazenada
Detecções do VirusTotal: 12/89 Correspondências da lista de bloqueio armazenada: 1 Representação da marca: Unknown Último ativo conhecido
OTX: 10 refs 22/09/2026 Desconhecido 1 Report Sent CDN
Actions API
⚠️
Este domínio foi sinalizado como malicioso
Mecanismos de segurança relatando uma detecção: 12. Listas de bloqueio públicas relatando uma correspondência: 1. Tenha extremo cuidado – não insira credenciais ou informações pessoais.
Resumo do relatório

digitalrushcapital.com — Último ativo conhecido (HTTP 200). Representação da marca: Unknown. Resumo das evidências: VirusTotal 12/89 (alphaMountain.ai, BitDefender, Chong Lua Dao, CyRadar, Forcepoint ThreatSeeker); URLQuery 3 det.; 1 external blocklist match (CryptoFirewall); PhishDestroy score 100/100. Registrador: GoDaddy.

A análise detalhada do PhishDestroy AI permanece em inglês para preservar o registro forense original.

Resumo das evidências

CRÍTICO
Pontuação
100/100

Assessment
Stored evidence for digitalrushcapital.com: VirusTotal recorded 12 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for digitalrushcapital.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 12 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for digitalrushcapital.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains digitalrushcapital.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed digitalrushcapital.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2025-04-07. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 160.153.0.6 as the observed address in this record. The registration date for digitalrushcapital.com is recorded as 2025-04-07. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The digitalrushcapital.com record states that VirusTotal recorded 12 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 160.153.0.6. The supported conclusion is bounded to the exact stored observations for digitalrushcapital.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to digitalrushcapital.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain digitalrushcapital.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to digitalrushcapital.com. The stored record does not justify extending that rule to 160.153.0.6 or to other infrastructure records.

VirusTotal
VirusTotal
12 det.
URLQuery
URLQuery
3 det.
OTX references
URLScan
URLScan
Certificado TLS
Google Trust Services / WE1
Idade
1.5 yr
Status observado
Último ativo conhecido 200
PhishDestroy
DestroyList
Listado
Reports Sent
1
Cobertura dos dados VirusTotal 12 / 89 URLQuery 3 det. OTX 10 community references CF Radar scan completed URLScan capture relatório armazenado URLScan verdict Análise concluída TLS valid certificate, 51d WHOIS 18 mo old Captura de tela 3 captures · 2 sources

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as unknown pointing to IP 160.153.0.6.

Pipeline de resposta a ameaças

Descoberta
Checks
Reports
Disponibilidade
13/14
Sent Report Recorded
Stored sent-report record for registrar GoDaddy.com, LLC, hosting provider, 1 abuse contact
abuse@godaddy.com
22/09/2026

Status da lista de bloqueios pública

Análise de detecção e evasão

Verificação de cloaking e distribuição de tráfego

Ainda não foi digitalizado Ainda não foi registrada nenhuma diferença entre o rastreador e o navegador

Observações armazenadas comparando o rastreador com o navegador para este host, além de uma verificação em tempo real da assinatura digital para sistemas de distribuição de tráfego do tipo Keitaro.

Sinalizador de camuflagem armazenado
Ainda não foi digitalizado
Última varredura de camuflagem
Cabeçalho do servidor detectado pelo scanner
cloudflare

Nota do digitalizador: alive_content: raw=ok; http=200; via=https_proxy; server=cloudflare

Verificação de impressão digital “TDS” em tempo real
Sete impressões digitais do Keitaro, além de uma comparação entre o crawler e o navegador, executadas a partir do scanner PhishDestroy quando este painel estiver aberto.
Esperando

Captura armazenada · 3 sources

Inteligência de Domínios

Domínio
URLScan Verdict Análise concluída score 0 report ↗
Servidor / ASN cloudflare · AS209242 Cloudflare London, LLC
IP Context Cloudflare shared edge origin IP hidden A reputação do Edge-IP não é atribuída a este domínio.
OTX Tags asciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsertinvisible characters+6 more
Registrador GoDaddy US(US)
Endereço IP 160.153.0.6 CDN
LocalizaçãoUS Tempe, US
RedeAS209242 · GoDaddy.com, LLC
O IP de origem está oculto atrás de um proxy CDN. Os resultados de IP reverso para o endereço de borda contêm locatários não relacionados; encontrar a origem requer DNS passivo ou dados de transparência de certificado.
RegistroCriado 07/04/2025 Expires 07/04/2027
Status HTTP200
Detalhes técnicosDNS, SANs do SSL, carimbos de data e hora
Detectado pela primeira vez22/09/2026
DOM Analysisanalyzed 23/09/2026score 98/100
Submitted URLhttp://digitalrushcapital.com/
Servidores de nomesns31.domaincontrol.comns32.domaincontrol.com
MX Records1 aspmx.l.google.com 5 alt2.aspmx.l.google.com 5 alt1.aspmx.l.google.com 10 alt4.aspmx.l.google.com 10 alt3.aspmx.l.google.com
TLS Fingerprint
TLS Observationvalid from 15/08/2026scanned 23/09/2026
Favicon Hash
ID do caso
Título da página
Digital Rush Capital
Certificado TLS
Valid transport encryption · Emitido por Google Trust Services / WE1 · valid for 51 days
Tecnologias · 9 identified
Detected via Cloudflare Radar · Wappalyzer engine
Denunciar este domínio Envie evidências e ajude a proteger outras pessoas

Análise do VirusTotal

12 / Os fornecedores de segurança 89 sinalizaram este domínio
View on VT
Last analyzed
alphaMountain.ai
BitDefender
Chong Lua Dao
CyRadar
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
Lionic
SOCRadar
Sophos
Viettel Threat Intelligence

Evidências e relatórios externos

Instantâneo das evidências enviadas
Sent: Ledger records: 1 Case ID: PD-20260922-102833 Recipient: abuse@godaddy.com
Page title stored with report: Digital Rush Capital
URLScan evidence VirusTotal evidence URLQuery evidence Screenshot 297.2 KB
PDF notice generated Notice text archived (650 chars)
Abuse notice text as sent to the provider
Policy Violations:
Illegal Activities: Active phishing operation targeting victims
Fraud & Deception: Impersonation of legitimate services
Identity Theft: Collection of credentials under false pretenses
Applicable Laws (Unknown):
International Anti-Cybercrime Regulations
Budapest Convention on Cybercrime
Universal Fraud Prevention Laws
Phishing activities violate international cybercrime conventions and Unknown's domestic fraud laws.
Action Required: This evidence-backed report demonstrates clear violations requiring suspension per your policies. Continued hosting exposes your organization to regulatory scrutiny and potential legal liability.

Você foi afetado por este site?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

Se você inseriu credenciais de conta, informações pessoais ou de pagamento, ou baixou um arquivo deste domínio, tome medidas imediatas. Abaixo estão os recursos para ajudá-lo a relatar o incidente e se proteger.

Europol
Encontre o canal de denúncia oficial do seu país da UE
National police directory
Cuidado com os golpistas que prometem recuperação! Os criminosos podem entrar em contato novamente com as vítimas fingindo ser investigadores, advogados ou agentes de recuperação. Não pague taxas antecipadas nem compartilhe credenciais. Saiba mais sobre fraudes relacionadas à recuperação →

Notifique as autoridades locais

Selecione seu país para obter contactos oficiais do cibercrime ou crie um rascunho de reclamação →.

Diretório de 97 países
Rascunho assistido por IA – os detalhes do incidente são processados pelo provedor de IA Revise e envie você mesmo

Verificar qualquer domínio

Análise de ameaças usando lista de bloqueio armazenada, WHOIS, DNS e evidências de verificação pública

Digitalize agora

Denunciar phishing

Envie domínios suspeitos para nosso banco de dados de ameaças — proteja a comunidade

Denunciar

Feed de ameaças em tempo real

Relatórios recentes de phishing e alterações de disponibilidade observadas

Monitorar

Mantenha-se informado, mantenha-se seguro

Monitore ameaças em tempo real ou conteste esta listagem caso acredite que se trate de um falso positivo

Feed de ameaças em tempo real Recorrer deste anúncio
HTML · IFRAME

Incorporar este relatório

Compartilhe essas informações sobre ameaças em seu site ou blog

embed.html
<iframe
  src="https://phishdestroy.io/pt-br/embed/domain/digitalrushcapital.com"
  title="PhishDestroy threat report for digitalrushcapital.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>