보안 보고서로 이동
도메인 보안 및 위협 인텔리전스
rocketboostfunding.com favicon

rocketboostfunding.com

위협 평결 심각 75/100 증거 점수
가용성 확인되지 않음 현재 연결 가능성이 확인되지 않았습니다.
VirusTotal 탐지: 8/89 저장된 차단 목록 일치 항목: 1
OTX: 10 refs 2026년 9월 22일
Actions API
⚠️
이 도메인은 악성 도메인으로 표시되었습니다.
탐지를 보고하는 보안 엔진: 8. 일치를 보고하는 공개 차단 목록: 1. 극도의 주의를 기울이십시오 — 자격 증명이나 개인 정보를 입력하지 마십시오.
보고서 요약

rocketboostfunding.com — 확인되지 않음. 증거 요약: VirusTotal 8/89 (alphaMountain.ai, BitDefender, Forcepoint ThreatSeeker, Fortinet, G-Data); URLScan capture; 1 external blocklist match (CryptoFirewall); PhishDestroy score 75/100. 등록기관: GoDaddy.

원본 포렌식 기록을 보존하기 위해 아래의 상세 PhishDestroy AI 분석은 영어로 유지됩니다.

증거 요약

중요
점수
75/100

Assessment
Stored evidence for rocketboostfunding.com: VirusTotal recorded 8 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for rocketboostfunding.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 8 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for rocketboostfunding.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains rocketboostfunding.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed rocketboostfunding.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2024-10-08. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 160.153.0.108 as the observed address in this record. The registration date for rocketboostfunding.com is recorded as 2024-10-08. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The rocketboostfunding.com record states that VirusTotal recorded 8 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 160.153.0.108. The supported conclusion is bounded to the exact stored observations for rocketboostfunding.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to rocketboostfunding.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain rocketboostfunding.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to rocketboostfunding.com. The stored record does not justify extending that rule to 160.153.0.108 or to other infrastructure records.

VirusTotal
VirusTotal
8 det.
OTX references
URLScan
URLScan
연령
2 yr
관측 상태
확인되지 않음
PhishDestroy
DestroyList
등재됨
데이터 적용 범위 VirusTotal 8 / 89 OTX 10 community references URLScan capture 저장된 보고서 TLS 인증서 데이터 없음 WHOIS 24 mo old 스크린샷 3 captures · 2 sources

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as alive pointing to IP 160.153.0.108.

위협 대응 Pipeline

발견
Checks
Reports
가용성
10/12

공개 차단 목록 상태

탐지 회피 분석

클로킹 및 트래픽 분산 점검

아직 스캔되지 않았습니다 크롤러와 브라우저 간의 차이는 아직 보고된 바가 없습니다.

이 호스트에 대해 저장된 크롤러 대 브라우저 관측 데이터와, 케이타로 스타일의 트래픽 분배 시스템을 위한 실시간 지문 확인 정보.

저장된 은신 플래그
아직 스캔되지 않았습니다
TDS 지문 인식 실시간 확인
이 패널이 열려 있을 때 PhishDestroy 스캐너에서 실행되는 7개의 케이타로 지문과 크롤러 대 브라우저 비교 결과.
기다림

저장된 캡처 · 3 sources

도메인 인텔리전스

도메인
OTX Tags asciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsertinvisible characters+6 more
등록기관 GoDaddy US(US)
악용 신고 연락처abuse@godaddy.com
등록 정보생성됨 2024년 10월 8일 Expires 2026년 10월 8일
기술 세부 정보DNS, SSL SAN, 타임스탬프
최초 발견2026년 9월 22일
Submitted URLhttp://rocketboostfunding.com/
네임서버ns27.domaincontrol.comns28.domaincontrol.com
Favicon Hash
이 도메인 신고하기 증거를 제출하고 다른 사람들을 보호하는 데 힘을 보태주세요

VirusTotal 분석

8 / 89 보안 공급업체가 이 도메인에 플래그를 지정했습니다.
View on VT
Last analyzed
alphaMountain.ai
BitDefender
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
SOCRadar
소포스

증거 및 외부 보고서

이 사이트로 인해 영향을 받으셨나요?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

계정 자격 증명, 개인 정보 또는 결제 정보를 입력했거나 이 도메인에서 파일을 다운로드한 경우 즉시 조치를 취하세요. 다음은 사건을 신고하고 자신을 보호하는 데 도움이 되는 리소스입니다.

유로폴
EU 국가의 공식 신고 채널 찾기
National police directory
회복 사기꾼들을 조심하세요! 범죄자는 수사관, 변호사, 회복요원인 척 하면서 피해자에게 다시 연락할 수도 있습니다. 선불 비용을 지불하거나 자격 증명을 공유하지 마십시오. 회복 관련 사기에 대해 자세히 알아보기 →

지역 당국에 신고하십시오

공식 사이버 범죄 연락처 또는 불만사항 초안 작성 →를 받으려면 국가를 선택하세요.

97개국 디렉토리
AI 지원 초안 - 사고 세부정보는 AI 제공업체에서 처리됩니다. 직접 검토하고 제출하세요.

모든 도메인 확인

저장된 차단 목록, WHOIS, DNS 및 공개 스캔 증거를 사용한 위협 분석

지금 스캔하기

피싱 신고

의심스러운 도메인을 당사의 위협 데이터베이스에 신고해 주세요 — 커뮤니티를 보호해 주세요

보고서

실시간 위협 정보

최근 피싱 보고서 및 관찰된 가용성 변경 사항

모니터링

최신 정보를 확인하고, 안전을 지키세요

실시간 위협을 모니터링하거나, 오탐이라고 판단될 경우 이 목록에 이의를 제기하십시오.

실시간 위협 정보 이 목록에 이의 제기하기
HTML · IFRAME

이 보고서 삽입하기

이 위협 정보를 귀하의 웹사이트나 블로그에 공유하세요

embed.html
<iframe
  src="https://phishdestroy.io/ko/embed/domain/rocketboostfunding.com"
  title="PhishDestroy threat report for rocketboostfunding.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>