보안 보고서로 이동
도메인 보안 및 위협 인텔리전스
catalystcapitalharbor.com favicon

catalystcapitalharbor.com

“Catalyst Capital Harbor”

위협 평결 심각 100/100 증거 점수
가용성 마지막으로 알려진 활성 최근에 저장된 도달 가능성 관찰
VirusTotal 탐지: 16/89 저장된 차단 목록 일치 항목: 1 브랜드 사칭: Unknown 마지막으로 알려진 활성
OTX: 10 refs 2026년 9월 22일 알 수 없음 1 Report Sent CDN
Actions API
⚠️
이 도메인은 악성 도메인으로 표시되었습니다.
탐지를 보고하는 보안 엔진: 16. 일치를 보고하는 공개 차단 목록: 1. 극도의 주의를 기울이십시오 — 자격 증명이나 개인 정보를 입력하지 마십시오.
보고서 요약

catalystcapitalharbor.com — 마지막으로 알려진 활성 (HTTP 200). 브랜드 사칭: Unknown; 사기 유형: Impersonation. 증거 요약: VirusTotal 16/89 (alphaMountain.ai, BitDefender, Chong Lua Dao, CRDF, CyRadar); URLQuery 3 det.; 1 external blocklist match (CryptoFirewall); PhishDestroy score 100/100. 등록기관: GoDaddy.

원본 포렌식 기록을 보존하기 위해 아래의 상세 PhishDestroy AI 분석은 영어로 유지됩니다.

증거 요약

중요
점수
100/100

Assessment
Stored evidence for catalystcapitalharbor.com: VirusTotal recorded 16 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for catalystcapitalharbor.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 16 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for catalystcapitalharbor.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains catalystcapitalharbor.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed catalystcapitalharbor.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2025-09-23. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 160.153.0.27 as the observed address in this record. The registration date for catalystcapitalharbor.com is recorded as 2025-09-23. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The catalystcapitalharbor.com record states that VirusTotal recorded 16 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 160.153.0.27. The supported conclusion is bounded to the exact stored observations for catalystcapitalharbor.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to catalystcapitalharbor.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain catalystcapitalharbor.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to catalystcapitalharbor.com. The stored record does not justify extending that rule to 160.153.0.27 or to other infrastructure records.

VirusTotal
VirusTotal
16 det.
URLQuery
URLQuery
3 det.
OTX references
URLScan
URLScan
TLS 인증서
Google Trust Services / WE1
연령
12 mo
관측 상태
마지막으로 알려진 활성 200
PhishDestroy
DestroyList
등재됨
Reports Sent
1
데이터 적용 범위 VirusTotal 16 / 89 URLQuery 3 det. OTX 10 community references CF 레이더 scan completed URLScan capture 저장된 보고서 URLScan verdict 분석 완료 TLS valid certificate, 57d WHOIS 12 mo old 스크린샷 3 captures · 2 sources

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as alive pointing to IP 160.153.0.27.

위협 대응 Pipeline

발견
Checks
Reports
가용성
13/14
Sent Report Recorded
Stored sent-report record for registrar GoDaddy.com, LLC, hosting provider, 1 abuse contact
abuse@godaddy.com
2026년 9월 22일

공개 차단 목록 상태

탐지 회피 분석

클로킹 및 트래픽 분산 점검

아직 스캔되지 않았습니다 크롤러와 브라우저 간의 차이는 아직 보고된 바가 없습니다.

이 호스트에 대해 저장된 크롤러 대 브라우저 관측 데이터와, 케이타로 스타일의 트래픽 분배 시스템을 위한 실시간 지문 확인 정보.

저장된 은신 플래그
아직 스캔되지 않았습니다
마지막 은폐 스캔
스캐너가 감지한 서버 헤더
cloudflare

스캐너 메모: alive_content: raw=ok; http=200; via=https_proxy; server=cloudflare

TDS 지문 인식 실시간 확인
이 패널이 열려 있을 때 PhishDestroy 스캐너에서 실행되는 7개의 케이타로 지문과 크롤러 대 브라우저 비교 결과.
기다림

저장된 캡처 · 3 sources

도메인 인텔리전스

도메인
URLScan Verdict 분석 완료 score 0 report ↗
서버 / ASN cloudflare · AS209242 Cloudflare London, LLC
IP Context Cloudflare shared edge origin IP hidden Edge-IP 평판은 이 도메인에 귀속되지 않습니다.
OTX Tags asciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsertinvisible characters+6 more
등록기관 GoDaddy US(US)
악용 신고 연락처abuse@godaddy.com
IP 주소 160.153.0.27 CDN
위치US Tempe, US
네트워크AS209242 · GoDaddy.com, LLC
원본 IP는 CDN 프록시 뒤에 숨겨져 있습니다. 에지 주소에 대한 역방향 IP 결과에는 관련되지 않은 테넌트가 포함되어 있습니다. 원본을 찾으려면 수동 DNS 또는 인증서 투명성 데이터가 필요합니다.
등록 정보생성됨 2025년 9월 23일 (364d) Expires 2026년 9월 23일
HTTP 상태200
기술 세부 정보DNS, SSL SAN, 타임스탬프
최초 발견2026년 9월 22일
IoC Extractionscanned 2026년 9월 23일0 wallet · 0 Telegram IoCs
Submitted URLhttp://catalystcapitalharbor.com/
네임서버ns75.domaincontrol.comns76.domaincontrol.com
MX Records1 aspmx.l.google.com 5 alt1.aspmx.l.google.com 5 alt2.aspmx.l.google.com 10 alt3.aspmx.l.google.com 10 alt4.aspmx.l.google.com
TLS Fingerprint
TLS Observationvalid from 2026년 8월 21일scanned 2026년 9월 23일
Favicon Hash
사건 ID
페이지 제목
Catalyst Capital Harbor
TLS 인증서
Valid transport encryption · 발급자 Google Trust Services / WE1 · valid for 57 days
기술 · 9 identified
Detected via Cloudflare Radar · Wappalyzer engine
이 도메인 신고하기 증거를 제출하고 다른 사람들을 보호하는 데 힘을 보태주세요

VirusTotal 분석

16 / 89 보안 공급업체가 이 도메인에 플래그를 지정했습니다.
View on VT
Last analyzed
alphaMountain.ai
BitDefender
Chong Lua Dao
CRDF
CyRadar
ESET
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
Lionic
SOCRadar
소포스
Viettel Threat Intelligence
VIPRE
Webroot
사이트 성능 분석

Google PageSpeed Insights — mobile performance audit of catalystcapitalharbor.com · checked Sep 22, 2026

46
Poor
Performance
FCP
6.45s
First Contentful Paint
LCP
13.46s
Largest Contentful Paint
CLS
0.229
Cumulative Layout Shift
TBT
0ms
Total Blocking Time
SI
7.48s
Speed Index
Powered by Google PageSpeed Insights · Mobile strategy · Scores: 90-100 Good 50-89 Needs Work 0-49 Poor

증거 및 외부 보고서

제출된 증거 스냅샷
Sent: Ledger records: 1 Case ID: PD-20260922-BC7C1E Recipient: abuse@godaddy.com
Page title stored with report: Catalyst Capital Harbor
URLScan evidence VirusTotal evidence URLQuery evidence Screenshot 565.3 KB
PDF notice generated Notice text archived (650 chars)
Abuse notice text as sent to the provider
Policy Violations:
Illegal Activities: Active phishing operation targeting victims
Fraud & Deception: Impersonation of legitimate services
Identity Theft: Collection of credentials under false pretenses
Applicable Laws (Unknown):
International Anti-Cybercrime Regulations
Budapest Convention on Cybercrime
Universal Fraud Prevention Laws
Phishing activities violate international cybercrime conventions and Unknown's domestic fraud laws.
Action Required: This evidence-backed report demonstrates clear violations requiring suspension per your policies. Continued hosting exposes your organization to regulatory scrutiny and potential legal liability.

이 사이트로 인해 영향을 받으셨나요?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

계정 자격 증명, 개인 정보 또는 결제 정보를 입력했거나 이 도메인에서 파일을 다운로드한 경우 즉시 조치를 취하세요. 다음은 사건을 신고하고 자신을 보호하는 데 도움이 되는 리소스입니다.

유로폴
EU 국가의 공식 신고 채널 찾기
National police directory
회복 사기꾼들을 조심하세요! 범죄자는 수사관, 변호사, 회복요원인 척 하면서 피해자에게 다시 연락할 수도 있습니다. 선불 비용을 지불하거나 자격 증명을 공유하지 마십시오. 회복 관련 사기에 대해 자세히 알아보기 →

지역 당국에 신고하십시오

공식 사이버 범죄 연락처 또는 불만사항 초안 작성 →를 받으려면 국가를 선택하세요.

97개국 디렉토리
AI 지원 초안 - 사고 세부정보는 AI 제공업체에서 처리됩니다. 직접 검토하고 제출하세요.

모든 도메인 확인

저장된 차단 목록, WHOIS, DNS 및 공개 스캔 증거를 사용한 위협 분석

지금 스캔하기

피싱 신고

의심스러운 도메인을 당사의 위협 데이터베이스에 신고해 주세요 — 커뮤니티를 보호해 주세요

보고서

실시간 위협 정보

최근 피싱 보고서 및 관찰된 가용성 변경 사항

모니터링

최신 정보를 확인하고, 안전을 지키세요

실시간 위협을 모니터링하거나, 오탐이라고 판단될 경우 이 목록에 이의를 제기하십시오.

실시간 위협 정보 이 목록에 이의 제기하기
HTML · IFRAME

이 보고서 삽입하기

이 위협 정보를 귀하의 웹사이트나 블로그에 공유하세요

embed.html
<iframe
  src="https://phishdestroy.io/ko/embed/domain/catalystcapitalharbor.com"
  title="PhishDestroy threat report for catalystcapitalharbor.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>