Lompat ke laporan keamanan
Keamanan domain dan intelijen ancaman
catalystboostfunding.com favicon

catalystboostfunding.com

“Catalyst Boost Funding”

Putusan ancaman Kritis 100/100 skor bukti
Ketersediaan Terakhir diketahui aktif Pengamatan keterjangkauan tersimpan terbaru
Deteksi Total Virus: 14/89 Daftar blokir yang disimpan cocok: 1 Peniruan identitas merek: Unknown Terakhir diketahui aktif
OTX: 10 refs 22/09/2026 Tidak diketahui 1 Report Sent CDN
Actions API
⚠️
Domain ini telah ditandai sebagai berbahaya
Mesin keamanan melaporkan deteksi: 14. Daftar blokir publik yang melaporkan kecocokan: 1. Berhati-hatilah — jangan memasukkan kredensial atau informasi pribadi.
Ringkasan laporan

catalystboostfunding.com — Terakhir diketahui aktif (HTTP 200). Peniruan identitas merek: Unknown. Ringkasan bukti: VirusTotal 14/89 (alphaMountain.ai, Bfore.Ai PreCrime, BitDefender, Chong Lua Dao, Forcepoint ThreatSeeker); URLQuery 3 det.; URLScan capture; 1 external blocklist match (CryptoFirewall); CF Radar malicious; PhishDestroy score 100/100. Registrar: GoDaddy.

Analisis terperinci PhishDestroy AI di bawah tetap berbahasa Inggris untuk menjaga catatan forensik asli.

Ringkasan bukti

KRITIS
Skor
100/100

Assessment
Stored evidence for catalystboostfunding.com: VirusTotal recorded 14 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for catalystboostfunding.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 14 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for catalystboostfunding.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains catalystboostfunding.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed catalystboostfunding.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2025-09-09. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 160.153.0.86 as the observed address in this record. The registration date for catalystboostfunding.com is recorded as 2025-09-09. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The catalystboostfunding.com record states that VirusTotal recorded 14 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 160.153.0.86. The supported conclusion is bounded to the exact stored observations for catalystboostfunding.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to catalystboostfunding.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain catalystboostfunding.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to catalystboostfunding.com. The stored record does not justify extending that rule to 160.153.0.86 or to other infrastructure records.

VirusTotal
VirusTotal
14 det.
URLQuery
URLQuery
3 det.
OTX references
CF Radar
Berbahaya
URLScan
URLScan
ScamAdviser
Scamadviser
80/100Likely Safe
Sertifikat TLS
Google Trust Services / WE1
Usia
1 yr
Status terpantau
Terakhir diketahui aktif 200
PhishDestroy
Daftar Hapus
Terdaftar
Reports Sent
1
Cakupan data VirusTotal 14 / 89 URLQuery 3 det. OTX 10 community references CF Radar provider verdict: malicious URLScan capture laporan yang disimpan TLS valid certificate, 57d WHOIS 13 mo old Tangkapan layar 3 captures · 2 sources Scamadviser 80/100
Intelijen Keamanan Jaringan
CF Cloudflare Radar Verdict Berbahaya
Security threats Malware Malware

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as alive pointing to IP 160.153.0.86.

Alur Tanggapan Ancaman Pipeline

Penemuan
Checks
Reports
Ketersediaan
13/14
Sent Report Recorded
Stored sent-report record for registrar GoDaddy.com, LLC, hosting provider, 1 abuse contact
abuse@godaddy.com
22/09/2026

Status Daftar Blokir Publik

Analisis deteksi dan penghindaran

Pemeriksaan penyamaran dan distribusi lalu lintas

Belum dipindai Belum ada perbedaan yang tercatat antara crawler dan browser

Data pengamatan perbandingan crawler versus browser yang telah disimpan untuk host ini, ditambah pemeriksaan sidik jari secara real-time untuk sistem distribusi lalu lintas bergaya Keitaro.

Bendera penyamaran yang tersimpan
Belum dipindai
Pemindaian penyamaran terakhir
Header server yang terlihat oleh pemindai
cloudflare

Catatan pemindai: alive_content: raw=ok; http=200; via=https_proxy; server=cloudflare

Pemeriksaan sidik jari secara langsung melalui TDS
Tujuh sidik jari Keitaro ditambah perbandingan antara crawler dan browser; jalankan dari pemindai PhishDestroy saat panel ini terbuka.
Menunggu

Tangkapan tersimpan · 3 sources

Intelijen Domain

Domain
Server / ASN AS209242 Cloudflare London, LLC
IP Context Cloudflare shared edge origin IP hidden Reputasi Edge-IP tidak dikaitkan dengan domain ini.
OTX Tags asciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsertinvisible characters+6 more
Registrar GoDaddy US(US)
Alamat IP 160.153.0.86 CDN
LokasiUS Tempe, US
JaringanAS209242 · GoDaddy.com, LLC
IP asal tersembunyi di balik proksi CDN. Hasil IP terbalik untuk alamat edge berisi penyewa yang tidak terkait; menemukan asal memerlukan DNS pasif atau data transparansi sertifikat.
PendaftaranDibuat 09/09/2025 Expires 09/09/2027
Status HTTP200
Detail teknisDNS, SAN SSL, cap waktu
Pertama Kali Terdeteksi22/09/2026
DOM Analysisanalyzed 23/09/2026score 98/1001 brand signal
Submitted URLhttp://catalystboostfunding.com/
Server namans31.domaincontrol.comns32.domaincontrol.com
MX Records1 aspmx.l.google.com 5 alt1.aspmx.l.google.com 5 alt2.aspmx.l.google.com 10 alt4.aspmx.l.google.com 10 alt3.aspmx.l.google.com
TLS Fingerprint
TLS Observationvalid from 21/08/2026scanned 23/09/2026
Favicon Hash
ID kasus
Judul Halaman
Catalyst Boost Funding
Impersonates
Google
Sertifikat TLS
Valid transport encryption · Diterbitkan oleh Google Trust Services / WE1 · valid for 57 days
Referensi Silang Intelijen Ancaman · source references
ScamAdviser Public lookup
A public ScamAdviser lookup is available. Review its current score and warnings at the source; the existence of a lookup page is not itself a malicious verdict.
View on ScamAdviser
Live-fetched via CF worker proxy pool · cached 24h
Teknologi · 10 identified
Detected via Cloudflare Radar · Wappalyzer engine
Laporkan Domain Ini Kirimkan bukti & bantu lindungi orang lain

Analisis VirusTotal

14 / Vendor keamanan 89 menandai domain ini
View on VT
Last analyzed
alphaMountain.ai
Bfore.Ai PreCrime
BitDefender
Chong Lua Dao
Forcepoint ThreatSeeker
Fortinet
Gridinsoft
Lionic
Seclookup
SOCRadar
Sophos
Viettel Threat Intelligence
VIPRE
Webroot

Bukti & Laporan Eksternal

Snapshot bukti yang dikirim
Sent: Ledger records: 1 Case ID: PD-20260922-4A00E2 Recipient: abuse@godaddy.com
Page title stored with report: Catalyst Boost Funding
URLScan evidence VirusTotal evidence URLQuery evidence Screenshot 517.9 KB
PDF notice generated Notice text archived (650 chars)
Abuse notice text as sent to the provider
Policy Violations:
Illegal Activities: Active phishing operation targeting victims
Fraud & Deception: Impersonation of legitimate services
Identity Theft: Collection of credentials under false pretenses
Applicable Laws (Unknown):
International Anti-Cybercrime Regulations
Budapest Convention on Cybercrime
Universal Fraud Prevention Laws
Phishing activities violate international cybercrime conventions and Unknown's domestic fraud laws.
Action Required: This evidence-backed report demonstrates clear violations requiring suspension per your policies. Continued hosting exposes your organization to regulatory scrutiny and potential legal liability.

Apakah Anda Terpengaruh oleh Situs Ini?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

Jika Anda memasukkan kredensial akun, informasi pribadi atau pembayaran, atau mengunduh file dari domain ini, segera ambil tindakan. Di bawah ini adalah sumber daya untuk membantu Anda melaporkan insiden tersebut dan melindungi diri Anda sendiri.

Europol
Temukan saluran pelaporan resmi untuk negara UE Anda
National police directory
Waspadalah terhadap penipu yang mengatasnamakan pemulihan! Penjahat dapat menghubungi korban lagi sambil berpura-pura menjadi penyelidik, pengacara, atau agen pemulihan. Jangan membayar biaya di muka atau membagikan kredensial. Pelajari lebih lanjut tentang penipuan dalam proses pemulihan →

Laporkan kepada Pihak Berwenang di Daerah Anda

Pilih negara Anda untuk mendapatkan kontak resmi kejahatan dunia maya, atau membuat draf pengaduan →.

Direktori 97 negara
Draf yang dibantu AI — detail insiden diproses oleh penyedia AI Tinjau dan kirimkan sendiri

Periksa Domain Apa Pun

Analisis ancaman menggunakan daftar blokir yang disimpan, WHOIS, DNS, dan bukti pemindaian publik

Pindai Sekarang

Laporkan Phishing

Laporkan domain yang mencurigakan ke basis data ancaman kami — lindungi komunitas

Laporan

Pemberitahuan Ancaman Real-Time

Laporan phishing terbaru dan perubahan ketersediaan yang diamati

Pantau

Tetap Terinformasi, Tetap Aman

Pantau ancaman secara langsung atau ajukan keberatan terhadap daftar ini jika Anda yakin ini merupakan false positive

Pemberitahuan Ancaman Real-Time Ajukan Banding Terhadap Iklan Ini
HTML · IFRAME

Sematkan Laporan Ini

Bagikan informasi ancaman ini di situs web atau blog Anda

embed.html
<iframe
  src="https://phishdestroy.io/id/embed/domain/catalystboostfunding.com"
  title="PhishDestroy threat report for catalystboostfunding.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>