⚠️
This domain has been flagged as malicious
Detected by 13 security vendors. Exercise extreme caution — do not enter personal information or connect wallets.

smtptelstrawebmailplusviewswifts[.]framer[.]website

“Sign in with your Telstra ID”

13/95 VT URLQuery: 100 Taken Down Nov 06, 2025 Telstra
100 Threat
PhishDestroy AI
HIGH
Ref
D57A8ED2
Score
100/100
Engine
PD-4 Turbo
PhishDestroy's automated scanning systems detected smtpTelstrawebmailplusviewswifts[.]framer[.]website as a deceptive credential-stealing page. VirusTotal reports 13/95 detections for this domain. The page mimics the appearance of Telstra to trick visitors. The page presents itself as "Sign in with your Telstra ID".

Registration records show that smtptelstrawebmailplusviewswifts[.]framer[.]website was registered through CSC Corporate Domains Inc., registered over 4 years ago. The resolved IP address is 35.71.142.77. The domain appears on 1 security blocklist.

This credential-stealing page is currently live and accessible. PhishDestroy has filed abuse reports and added smtptelstrawebmailplusviewswifts[.]framer[.]website to multiple blocklists. We advise all users to avoid interaction with this domain.
VT
VirusTotal
13 det.
UQ
URLQuery
100 det.
US
URLScan
Age
4.3 yr
Status
Down 403
PD
DestroyList
Listed
Reports
1

Threat Response Pipeline

Discovery
Submission
Legal
Takedown
19/20
Pre-emptive Discovery & Ingestion
30+ Proprietary Parsers · Infrastructure Analysis · Community Intelligence · Threat Ingested
4/4 ✓
30+ Proprietary Parsers
Distributed network scanning Google Ads (malvertising), SEO-manipulated results, Twitter/X, YouTube & Telegram campaigns
Infrastructure Analysis
dnstwist & typosquatting detection to catch look-alike domains targeting established brands
Community Intelligence
Real-time ingestion of community-reported threats via Telegram Bot & partner intelligence feeds
Threat Ingested
smtptelstrawebmailplusviewswifts.framer.website detected and queued for full analysis
Nov 06, 2025
Global Ecosystem Submission
54+ Vendor Submissions · URLScan.io Snapshot · Cloudflare Radar · VirusTotal · Brand Impersonation · Forensic Evidence Collection · Web Archive Preservation · Technical Deep Analysis · Cloudflare Radar Scan
9/9 ✓
54+ Vendor Submissions
Threat data submitted to 54+ security vendors & threat intelligence platforms
Show all 54 vendors
SpamhausCloudflareGoogle Safe BrowsingMicrosoft SecurityVirusTotalNetcraftESETBitdefenderNorton Safe WebAviraPhishTankDr.WebYandex Safe BrowsingURLScan.ioPolySwarmSiteReviewURLQueryPhishStatsPhishReportIsItPhishThreatCenterKasperskyOpenPhishAPWG eCrimeComodo / XcitiumFortinet / FortiGuardPalo Alto NetworksSophosTrend MicroWebrootZeroFOXSURBLAbusixCRDF LabsQuad9CleanBrowsingCyRadarScumware.orgPhishing.DatabaseMalware PatrolANY.RUNHybrid AnalysisURLhausMalwareBazaarThreatFoxAbuse.chAbuseIPDBAlienVault OTXMISPDomainToolsSecurityTrailsCensysBinaryEdgeCIRCL
URLScan.io Snapshot
Submitted to urlscan.io — screenshot, DOM & HTTP transactions captured
Nov 06, 2025
Cloudflare Radar
Scanned via Cloudflare Radar — DNS, certificates & network data
VirusTotal
13 / 95 vendors flagged on VirusTotal
Feb 23, 2026
Brand Impersonation
Impersonation of Telstra
Forensic Evidence Collection
Public scans via URLScan.io, URLQuery & Cloudflare Radar — DOM snapshots, HTTP transactions, DNS & certificate data
Web Archive Preservation
Site preserved in Wayback Machine — immutable copy of phishing content for legal evidence
Technical Deep Analysis
JS source analysis, directory enumeration, open directories scan, email harvesting, Telegram bot detection, exposed databases & other OSINT artifacts useful for threat actor identification
Cloudflare Radar Scan
Scanned via Cloudflare Radar — network analysis completed
Feb 27, 2026
Legal Notifications & Reporting
Registrar & Hosting Notification · DestroyList Published · Abuse Report Pending · Conditional Re-detection
3/4
Registrar & Hosting Notification
Initial abuse reports sent to domain registrar (CSC Corporate Domains Inc.) and hosting provider with forensic evidence packages (metadata, screenshots, PDF)
DestroyList Published
Added to PhishDestroy/DestroyList — open-source blocklist for wallets & extensions
Nov 06, 2025
Abuse Report Pending
Will be sent to registrar (CSC Corporate Domains Inc.) & hosting
Conditional Re-detection
Follow-up alerts only if threat remains active beyond 24 hours — prevents spam, ensures reports contain active evidence
ICANN Escalation — triggered only on re-detection (24h+ active threat), not on initial report. Formal complaint per RAA §3.18 with full forensic evidence
Public Transparency & Takedown
Open Threat Database · Social Broadcasting · Domain Taken Down
3/3 ✓
Open Threat Database
Real-time commits to GitHub repository & live monitoring at phishdestroy.io/live
Social Broadcasting
Automated alerts on Twitter, Telegram & Mastodon channels
Domain Taken Down
Phishing site is offline — no longer serving malicious content

Public Blocklist Status

Evidence Capture

Snapshot
2025-11-06 14:32 UTC
Malicious
Forensic screenshot of smtptelstrawebmailplusviewswifts.framer.website
IP: 35.71.142.77
CSC Corporate Domains Inc.
1,562d

Domain Intelligence

Domainsmtptelstrawebmailplusviewswifts.framer.website
IP Address35.71.142.77
CreatedNov 19, 2021
ExpiresNov 19, 2026
Nameserversns-1243.awsdns-27.org
ns-1818.awsdns-35.co.uk
ns-336.awsdns-42.com
ns-792.awsdns-35.net
Page TitleSign in with your Telstra ID
Abuse Contactsdomainabuse@cscglobal.com
First DetectedNov 06, 2025
HTTP Status403
Report This Domain Submit evidence & help protect others

VirusTotal Analysis

13 / 95 security vendors flagged this domain
View on VT
ADMINUSLabs
alphaMountain.ai
BitDefender
CyRadar
ESET
Forcepoint ThreatSeeker
G-Data
Kaspersky
Lionic
Phishing Database
Sophos
VIPRE
Webroot

Evidence & External Reports

Were You Affected by This Site?

You are not alone and there is nothing to be ashamed of. Scammers are sophisticated criminals who exploit trust. Reporting your experience is the most powerful weapon against fraud — your report can prevent others from becoming victims and help law enforcement take action. Silence is the scammer's greatest advantage. Break it.

If you have interacted with this domain, entered personal information, or connected a cryptocurrency wallet — take immediate action. Below are resources to help you report the incident and protect yourself.

Beware of recovery scammers! After being scammed, criminals may contact you again pretending to be "recovery agents," lawyers, or investigators who claim they can retrieve your lost funds — for a fee. This is a second scam. No legitimate service will ask for upfront payment to recover stolen crypto. Learn more about recovery fraud →

Report to Your Local Authorities

Select your country to see local cybercrime reporting contacts and complaint templates.

Select your country...

Related Domain Reports

dsjhfjdjh-hkdfjg-4a4589.netlify.app
21 detections · Similar title
tpbpcommunitels234.framer.website
20 detections · Similar title
saintdashboard.com
20 detections · Similar title
myid-telstra.flutterflow.app
19 detections · Similar title
kecoa4.mr-aleex.website
In DestroyList
play-sweet-bonanza-drk.website
19 detections
dr3z.closer.website
18 detections
velveroulette.website
10 detections

Other Domains on 35.71.142.77

creative-backgrounds-489117.framer.app 24 determined-employee-705783.framer.app 23 magenta-tenets-857917.framer.app 23 centered-video-625311.framer.app 22 happier-core-546146.framer.app 22 more-report-557996.framer.app 22

More Domains at CSC Corporate Domains Inc.

coinbase-sigin.framer.website 10 coimbase-pro.framer.website 6 swiftsubreviewwebmail.framer.website 12 upholldlog.framer.website 14 telstraaccountrecovoreysystem.framer.website 15 learn-metamsks.framer.website 7

Other Telstra Impersonation Domains

These domains also target Telstra users. View all Telstra threats →

dsjhfjdjh-hkdfjg-4a4589.netlify.app 21 tpbpcommunitels234.framer.website 20 fanciful-mochi-5f3a5e.netlify.app 19 fearless-calendar-501570.framer.app 19 grounded-course-230298.framer.app 19 myid-telstra.flutterflow.app 19 fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com 18 earlier-concept-180784.framer.app 18

About This Report: smtptelstrawebmailplusviewswifts.framer.website

This domain security report for smtptelstrawebmailplusviewswifts.framer.website is maintained by PhishDestroy's automated threat intelligence pipeline. Our system continuously monitors this domain across 95 security vendors on VirusTotal, URLScan.io.

The site displays a page titled “Sign in with your Telstra ID”, which may be designed to impersonate Telstra.

smtptelstrawebmailplusviewswifts.framer.website has been flagged by 13 security vendors as of March 1, 2026.

If you believe this listing is inaccurate, you can submit an appeal. For more information about our methodology, visit our FAQ page.

Stay Informed, Stay Safe

Monitor live threats or contest this listing if you believe it's a false positive

Live Threat Feed Appeal This Listing

Related Threat News

Live Feed
Bitcoinist · Feb 20 HIGH
Change Of Heart? Hacker Returns $21M Stolen Bitcoin To South Korean Prosecutors
A hacker has returned 320 Bitcoin (BTC) stolen from South Korean prosecutors throughout a phishing scam last year. As authorities face ba...
phishing hack scam
BleepingComputer · Feb 28 HIGH
If You�ve Been Scammed in Crypto, Read This Immediately
If You’ve Been Scammed in Crypto, Read This Immediately - posted in Windows Crashes and Blue Screen of Death (BSOD) Help and Support: If ...
wallet phishing scam
BleepingComputer · Feb 28 HIGH
Crypto Scam Recovery: Real Steps and Realistic Hope in 2026
Crypto Scam Recovery: Real Steps and Realistic Hope in 2026 - posted in Windows 10 Support: Discovering youve been scammed in crypto hits...
phishing scam
Cointelegraph · Feb 23 HIGH
How pig-butchering crypto scams turn trust into a financial weapon
Learn how pig-butchering crypto scams exploit emotional trust, fake profits and social engineering to drain millions from victims worldwide.
wallet hack scam