Zum Sicherheitsbericht springen
Domänensicherheit und Bedrohungsinformationen
yourlocfunding.com favicon

yourlocfunding.com

“Your Loc Funding”

Drohungsurteil Kritisch 100/100 Evidenzbewertung
Verfügbarkeit Letzter bekanntermaßen aktiv Letzte gespeicherte Erreichbarkeitsbeobachtung
VirusTotal-Erkennungen: 15/89 Gespeicherte Sperrlistenübereinstimmungen: 1 Markenidentität: Unknown Letzter bekanntermaßen aktiv
OTX: 12 refs 22.09.2026 Unbekannt 1 Report Sent CDN
Actions API
⚠️
Diese Domain wurde als bösartig markiert.
Sicherheits-Engines melden eine Entdeckung: 15. Öffentliche Blocklisten, die eine Übereinstimmung melden: 1. Seien Sie äußerst vorsichtig – Geben Sie keine Anmeldeinformationen oder persönlichen Daten ein.
Berichtsübersicht

yourlocfunding.com — Letzter bekanntermaßen aktiv (HTTP 200). Markenidentität: Unknown. Zusammenfassung der Beweislage: VirusTotal 15/89 (alphaMountain.ai, BitDefender, Chong Lua Dao, CyRadar, ESET); URLQuery 3 det.; URLScan capture; 1 external blocklist match (CryptoFirewall); PhishDestroy score 100/100. Registrar: GoDaddy.

Die ausführliche Analyse von PhishDestroy AI bleibt auf Englisch, damit der ursprüngliche forensische Bericht unverändert bleibt.

Zusammenfassung der Beweislage

KRITISCH
Bewertung
100/100

Assessment
Stored evidence for yourlocfunding.com: VirusTotal recorded 15 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for yourlocfunding.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 15 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for yourlocfunding.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains yourlocfunding.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed yourlocfunding.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2024-10-18. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 160.153.0.202 as the observed address in this record. The registration date for yourlocfunding.com is recorded as 2024-10-18. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The yourlocfunding.com record states that VirusTotal recorded 15 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 160.153.0.202. The supported conclusion is bounded to the exact stored observations for yourlocfunding.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to yourlocfunding.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain yourlocfunding.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to yourlocfunding.com. The stored record does not justify extending that rule to 160.153.0.202 or to other infrastructure records.

VirusTotal
VirusTotal
15 det.
URLQuery
URLQuery
3 det.
OTX references
URLScan
URLScan
TLS-Zertifikat
Google Trust Services / WE1
Alter
1.9 yr
Beobachteter Status
Letzter bekanntermaßen aktiv 200
PhishDestroy
DestroyList
Gelistet
Reports Sent
1
Datenabdeckung VirusTotal 15 / 89 URLQuery 3 det. OTX 12 community references CF-Radar scan completed URLScan capture gespeicherter Bericht TLS valid certificate, 51d WHOIS 23 mo old Screenshot 3 captures · 2 sources

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as unknown pointing to IP 160.153.0.202.

Pipeline zur Reaktion auf Sicherheitsbedrohungen

Entdeckung
Checks
Reports
Verfügbarkeit
12/13
Sent Report Recorded
Stored sent-report record for registrar GoDaddy.com, LLC, hosting provider, 1 abuse contact
abuse@godaddy.com
22.09.2026

Status der öffentlichen Sperrliste

Analyse von Erkennung und Umgehung

Überprüfung der Cloaking- und Traffic-Verteilung

Noch nicht eingescannt Bislang wurde noch kein Unterschied zwischen Crawler und Browser festgestellt.

Gespeicherte Beobachtungen zum Vergleich zwischen Crawler und Browser für diesen Host sowie eine Echtzeit-Fingerabdruckprüfung für Verkehrsverteilungssysteme im Keitaro-Stil.

Gespeichertes Cloaking-Flag
Noch nicht eingescannt
Letzter Tarnungsscan
Vom Scanner erkannter Server-Header
cloudflare

Anmerkung des Scanners: alive_content: raw=ok; http=200; via=https_proxy; server=cloudflare

Live-TDS-Fingerabdruckprüfung
Sieben Keitaro-Fingerabdrücke sowie ein Vergleich zwischen Crawler und Browser, der vom „PhishDestroy“-Scanner ausgeführt wird, wenn dieses Fenster geöffnet ist.
Warten

Gespeicherte Aufnahme · 3 sources

Domain-Intelligenz

Domain
Server / ASN AS209242 Cloudflare London, LLC
IP Context Cloudflare shared edge origin IP hidden Die Edge-IP-Reputation wird dieser Domäne nicht zugeordnet.
OTX Tags activecampaignasciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsert+6 more
Registrar GoDaddy US(US)
IP-Adresse 160.153.0.202 CDN
StandortUS Tempe, US
NetzwerkAS209242 · GoDaddy.com, LLC
Die Ursprungs-IP ist hinter einem CDN-Proxy verborgen. Reverse-IP-Ergebnisse für die Edge-Adresse enthalten nicht verwandte Mandanten; Um den Ursprung zu finden, sind passive DNS- oder Zertifikatstransparenzdaten erforderlich.
RegistrierungErstellt 18.10.2024 Expires 18.10.2026
HTTP-Status200
Technische DetailsDNS, SSL-SANs, Zeitstempel
Erstmals entdeckt22.09.2026
DOM Analysisanalyzed 23.09.2026score 98/100
Submitted URLhttp://yourlocfunding.com/
Nameserverns65.domaincontrol.comns66.domaincontrol.com
MX Records1 aspmx.l.google.com 5 alt2.aspmx.l.google.com 5 alt1.aspmx.l.google.com 10 alt4.aspmx.l.google.com 10 alt3.aspmx.l.google.com
TLS Fingerprint
TLS Observationvalid from 16.08.2026scanned 23.09.2026
Favicon Hash
Fall-ID
Seitentitel
Your Loc Funding
TLS-Zertifikat
Valid transport encryption · Ausgestellt von Google Trust Services / WE1 · valid for 51 days
Technologien · 9 identified
Detected via Cloudflare Radar · Wappalyzer engine
Diese Domain melden Reichen Sie Beweismaterial ein und helfen Sie mit, andere zu schützen

VirusTotal-Analyse

15 / 89 Sicherheitsanbieter haben diese Domain markiert
View on VT
Last analyzed
alphaMountain.ai
BitDefender
Chong Lua Dao
CyRadar
ESET
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
Lionic
SOCRadar
Sophos
Viettel Threat Intelligence
VIPRE
Webroot

Nachweise und externe Berichte

Momentaufnahme der übermittelten Beweise
Sent: Ledger records: 1 Case ID: PD-20260922-B88C90 Recipient: abuse@godaddy.com
Page title stored with report: Your Loc Funding
URLScan evidence VirusTotal evidence URLQuery evidence Screenshot 298.3 KB
PDF notice generated Notice text archived (650 chars)
Abuse notice text as sent to the provider
Policy Violations:
Illegal Activities: Active phishing operation targeting victims
Fraud & Deception: Impersonation of legitimate services
Identity Theft: Collection of credentials under false pretenses
Applicable Laws (Unknown):
International Anti-Cybercrime Regulations
Budapest Convention on Cybercrime
Universal Fraud Prevention Laws
Phishing activities violate international cybercrime conventions and Unknown's domestic fraud laws.
Action Required: This evidence-backed report demonstrates clear violations requiring suspension per your policies. Continued hosting exposes your organization to regulatory scrutiny and potential legal liability.

Wurden Sie von dieser Website betroffen?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

Wenn Sie Kontoanmeldeinformationen, persönliche oder Zahlungsinformationen eingegeben oder eine Datei von dieser Domain heruntergeladen haben, ergreifen Sie sofort Maßnahmen. Nachfolgend finden Sie Ressourcen, die Ihnen helfen, den Vorfall zu melden und sich zu schützen.

Europol
Finden Sie den offiziellen Meldekanal für Ihr EU-Land
National police directory
Vorsicht vor Betrügern, die mit der Rückforderung von Geldern locken! Kriminelle nehmen unter Umständen erneut Kontakt zu Opfern auf und geben dabei vor, Ermittler, Anwälte oder Beitreibungsbeamte zu sein. Zahlen Sie keine Vorabgebühren und geben Sie keine Anmeldeinformationen weiter. Erfahren Sie mehr über Betrug im Zusammenhang mit Wiederaufbaumaßnahmen →

Melden Sie sich bei Ihren örtlichen Behörden

Wählen Sie Ihr Land aus, um Offizielle Kontakte im Bereich Cyberkriminalität oder einen Beschwerdeentwurf erstellen → zu erhalten.

97-Länder-Verzeichnis
KI-gestützter Entwurf – Vorfalldetails werden vom KI-Anbieter verarbeitet Überprüfen Sie es und reichen Sie es selbst ein

Jede beliebige Domain prüfen

Bedrohungsanalyse anhand gespeicherter Blocklisten, WHOIS, DNS und öffentlicher Scan-Beweise

Jetzt scannen

Phishing melden

Melden Sie verdächtige Domains an unsere Bedrohungsdatenbank – schützen Sie die Community

Melden

Echtzeit-Bedrohungsfeed

Aktuelle Phishing-Meldungen und beobachtete Verfügbarkeitsänderungen

Überwachen

Bleiben Sie auf dem Laufenden, bleiben Sie sicher

Beobachten Sie aktuelle Bedrohungen oder legen Sie Widerspruch gegen diesen Eintrag ein, wenn Sie der Meinung sind, dass es sich um einen Fehlalarm handelt

Echtzeit-Bedrohungsfeed Einspruch gegen diesen Eintrag einlegen
HTML · IFRAME

Diesen Bericht einbetten

Teilen Sie diese Bedrohungsinformationen auf Ihrer Website oder in Ihrem Blog

embed.html
<iframe
  src="https://phishdestroy.io/de/embed/domain/yourlocfunding.com"
  title="PhishDestroy threat report for yourlocfunding.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>