الانتقال إلى تقرير الأمان
أمن المجال وذكاء التهديدات
onlinedirectfinance.com favicon

onlinedirectfinance.com

حكم التهديد حرجة 89/100 درجة الأدلة
التوفر لم يتم التحقق منها لم يتم التحقق من إمكانية الوصول الحالية
اكتشافات VirusTotal: 13/89 تطابقات القائمة السوداء المخزنة: 1
OTX: 11 refs 22/09/2026
Actions API
⚠️
تم الإبلاغ عن هذا النطاق باعتباره ضارًّا
محركات الأمان التي تبلغ عن اكتشاف: 13. قوائم الحظر العامة التي تبلغ عن تطابق: 1. توخي الحذر الشديد — لا تدخل بيانات الاعتماد أو المعلومات الشخصية.
ملخص التقرير

onlinedirectfinance.com — لم يتم التحقق منها. ملخص الأدلة: VirusTotal 13/89 (alphaMountain.ai, Chong Lua Dao, CyRadar, Forcepoint ThreatSeeker, Fortinet); URLScan capture; 1 external blocklist match (CryptoFirewall); PhishDestroy score 89/100. مسجّل النطاق: GoDaddy.

يبقى تحليل PhishDestroy AI المفصل أدناه باللغة الإنجليزية للحفاظ على السجل الجنائي الرقمي الأصلي.

ملخص الأدلة

حرج
الدرجة
89/100

Assessment
Stored evidence for onlinedirectfinance.com: VirusTotal recorded 13 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for onlinedirectfinance.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 13 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for onlinedirectfinance.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains onlinedirectfinance.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed onlinedirectfinance.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2021-05-13. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 192.169.222.135 as the observed address in this record. The registration date for onlinedirectfinance.com is recorded as 2021-05-13. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The onlinedirectfinance.com record states that VirusTotal recorded 13 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 192.169.222.135. The supported conclusion is bounded to the exact stored observations for onlinedirectfinance.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to onlinedirectfinance.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain onlinedirectfinance.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to onlinedirectfinance.com. The stored record does not justify extending that rule to 192.169.222.135 or to other infrastructure records.

VirusTotal
VirusTotal
13 det.
OTX references
العمر
5.4 yr
الحالة المرصودة
لم يتم التحقق منها
PhishDestroy
قائمة الإتلاف
مدرج
نطاق تغطية البيانات VirusTotal 13 / 89 OTX 11 community references URLScan capture التقرير المخزن TLS لا توجد بيانات للشهادة WHOIS 65 mo old لقطة شاشة 3 captures · 2 sources

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as unknown pointing to IP 192.169.222.135.

مسار الاستجابة للتهديدات Pipeline

الاكتشاف
Checks
Reports
التوفر
10/12

حالة قوائم الحظر العامة

تحليل الكشف والتهرب

فحص التمويه وتوزيع حركة المرور

لم يتم مسحها ضوئيًا بعد لم يُسجل حتى الآن أي اختلاف بين المتصفح والبرنامج الزاحف

الملاحظات المخزنة المتعلقة بالمقارنة بين برامج الزحف والمتصفح لهذا المضيف، بالإضافة إلى فحص مباشر للبصمة الرقمية لأنظمة توزيع حركة المرور على غرار «كيتارو».

علامة التخفي المخزنة
لم يتم مسحها ضوئيًا بعد
التحقق المباشر من بصمات الأصابع عبر تطبيق «TDS»
سبع بصمات «كيتارو» بالإضافة إلى مقارنة بين المتصفح المتنقل والمتصفح العادي، يتم تشغيلها من الماسح الضوئي PhishDestroy عند فتح هذه اللوحة.
الانتظار

لقطة محفوظة · 3 sources

معلومات النطاق

النطاق
OTX Tags activecampaignasciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsert+6 more
مسجّل النطاق GoDaddy US(US)
جهة الإبلاغ عن إساءة الاستخدامabuse@godaddy.com
البحث في قاعدة بيانات WHOISICANN RDAP لـ onlinedirectfinance.com →
عنوان IP 192.169.222.135
التسجيلتم إنشاؤه 13/05/2021 Expires 13/05/2027
التفاصيل التقنيةDNS، أسماء المجال البديلة (SAN) في بروتوكول SSL، الطوابع الزمنية
تاريخ أول اكتشاف22/09/2026
Submitted URLhttp://onlinedirectfinance.com/
خوادم الأسماءns45.domaincontrol.comns46.domaincontrol.com
Favicon Hash
الإبلاغ عن هذا النطاق أرسل الأدلة وساعد في حماية الآخرين

تحليل VirusTotal

13 / قام موردو الأمان 89 بوضع علامة على هذا المجال
View on VT
Last analyzed
alphaMountain.ai
Chong Lua Dao
CyRadar
Forcepoint ThreatSeeker
Fortinet
Gridinsoft
Lionic
Seclookup
SOCRadar
سوفوس
Viettel Threat Intelligence
VIPRE
Webroot
تحليل أداء الموقع

Google PageSpeed Insights — mobile performance audit of onlinedirectfinance.com · checked Sep 22, 2026

61
Needs Work
Performance
FCP
4.5s
First Contentful Paint
LCP
9.55s
Largest Contentful Paint
CLS
0.037
Cumulative Layout Shift
TBT
0ms
Total Blocking Time
SI
6.3s
Speed Index
Powered by Google PageSpeed Insights · Mobile strategy · Scores: 90-100 Good 50-89 Needs Work 0-49 Poor

الأدلة والتقارير الخارجية

نظام أسماء النطاقات (DNS) والشبكات
تحسين محركات البحث (SEO) والنطاقات

هل تأثرت بهذا الموقع؟

If credentials were compromised, report immediately. Do not engage with recovery scammers.

إذا أدخلت بيانات اعتماد الحساب أو المعلومات الشخصية أو معلومات الدفع أو قمت بتنزيل ملف من هذا النطاق، فاتخذ إجراءً فوريًا. فيما يلي موارد لمساعدتك في الإبلاغ عن الحادث وحماية نفسك.

اليوروبول
ابحث عن قناة التقارير الرسمية لبلدك في الاتحاد الأوروبي
National police directory
احذروا من المحتالين الذين يزعمون أنهم يساعدون في استرداد الأموال! قد يتصل المجرمون بالضحايا مرة أخرى بينما يتظاهرون بأنهم محققون أو محامون أو وكلاء استرداد. لا تدفع رسومًا مقدمة أو تشارك بيانات الاعتماد. تعرف على المزيد حول الاحتيال في مجال التعافي →

أبلغ السلطات المحلية

حدد بلدك للحصول على الاتصالات الرسمية المتعلقة بالجرائم الإلكترونية أو إنشاء مسودة شكوى →.

دليل 97 دولة
المسودة بمساعدة الذكاء الاصطناعي - تتم معالجة تفاصيل الحادث بواسطة موفر الذكاء الاصطناعي قم بمراجعتها وتقديمها بنفسك

تحقق من أي نطاق

تحليل التهديدات باستخدام قائمة الحظر المخزنة، وWHOIS، وDNS، وأدلة الفحص العامة

امسح الآن

الإبلاغ عن محاولة تصيد احتيالي

أرسل النطاقات المشبوهة إلى قاعدة بيانات التهديدات الخاصة بنا — ساهم في حماية المجتمع

إبلاغ

تحديثات فورية حول التهديدات

تقارير التصيد الاحتيالي الأخيرة وتغييرات التوفر الملحوظة

مراقبة

ابقَ على اطلاع، وابقَ آمنًا

راقب التهديدات في الوقت الفعلي أو اعترض على هذا الإدراج إذا كنت تعتقد أنه إنذار كاذب

تحديثات فورية حول التهديدات الاعتراض على هذا الإعلان
HTML · IFRAME

تضمين هذا التقرير

شارك هذه المعلومات الاستخباراتية المتعلقة بالتهديدات على موقعك الإلكتروني أو مدونتك

embed.html
<iframe
  src="https://phishdestroy.io/ar/embed/domain/onlinedirectfinance.com"
  title="PhishDestroy threat report for onlinedirectfinance.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>