الانتقال إلى تقرير الأمان
أمن المجال وذكاء التهديدات
catalystcapitalharbor.com favicon

catalystcapitalharbor.com

“Catalyst Capital Harbor”

حكم التهديد حرجة 100/100 درجة الأدلة
التوفر آخر نشاط معروف أحدث مراقبة إمكانية الوصول المخزنة
اكتشافات VirusTotal: 16/89 تطابقات القائمة السوداء المخزنة: 1 انتحال العلامة التجارية: Unknown آخر نشاط معروف
OTX: 10 refs 22/09/2026 غير معروف 1 Report Sent CDN
Actions API
⚠️
تم الإبلاغ عن هذا النطاق باعتباره ضارًّا
محركات الأمان التي تبلغ عن اكتشاف: 16. قوائم الحظر العامة التي تبلغ عن تطابق: 1. توخي الحذر الشديد — لا تدخل بيانات الاعتماد أو المعلومات الشخصية.
ملخص التقرير

catalystcapitalharbor.com — آخر نشاط معروف (HTTP 200). انتحال العلامة التجارية: Unknown; نوع الاحتيال: Impersonation. ملخص الأدلة: VirusTotal 16/89 (alphaMountain.ai, BitDefender, Chong Lua Dao, CRDF, CyRadar); URLQuery 3 det.; 1 external blocklist match (CryptoFirewall); PhishDestroy score 100/100. مسجّل النطاق: GoDaddy.

يبقى تحليل PhishDestroy AI المفصل أدناه باللغة الإنجليزية للحفاظ على السجل الجنائي الرقمي الأصلي.

ملخص الأدلة

حرج
الدرجة
100/100

Assessment
Stored evidence for catalystcapitalharbor.com: VirusTotal recorded 16 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for catalystcapitalharbor.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 16 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for catalystcapitalharbor.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains catalystcapitalharbor.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed catalystcapitalharbor.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2025-09-23. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 160.153.0.27 as the observed address in this record. The registration date for catalystcapitalharbor.com is recorded as 2025-09-23. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The catalystcapitalharbor.com record states that VirusTotal recorded 16 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 160.153.0.27. The supported conclusion is bounded to the exact stored observations for catalystcapitalharbor.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to catalystcapitalharbor.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain catalystcapitalharbor.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to catalystcapitalharbor.com. The stored record does not justify extending that rule to 160.153.0.27 or to other infrastructure records.

VirusTotal
VirusTotal
16 det.
URLQuery
URLQuery
3 det.
OTX references
شهادة TLS
Google Trust Services / WE1
العمر
12 mo
الحالة المرصودة
آخر نشاط معروف 200
PhishDestroy
قائمة الإتلاف
مدرج
Reports Sent
1
نطاق تغطية البيانات VirusTotal 16 / 89 URLQuery 3 det. OTX 10 community references رادار CF scan completed URLScan capture التقرير المخزن URLScan verdict اكتمل التحليل TLS valid certificate, 57d WHOIS 12 mo old لقطة شاشة 3 captures · 2 sources

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as alive pointing to IP 160.153.0.27.

مسار الاستجابة للتهديدات Pipeline

الاكتشاف
Checks
Reports
التوفر
13/14
Sent Report Recorded
Stored sent-report record for registrar GoDaddy.com, LLC, hosting provider, 1 abuse contact
abuse@godaddy.com
22/09/2026

حالة قوائم الحظر العامة

تحليل الكشف والتهرب

فحص التمويه وتوزيع حركة المرور

لم يتم مسحها ضوئيًا بعد لم يُسجل حتى الآن أي اختلاف بين المتصفح والبرنامج الزاحف

الملاحظات المخزنة المتعلقة بالمقارنة بين برامج الزحف والمتصفح لهذا المضيف، بالإضافة إلى فحص مباشر للبصمة الرقمية لأنظمة توزيع حركة المرور على غرار «كيتارو».

علامة التخفي المخزنة
لم يتم مسحها ضوئيًا بعد
آخر فحص للتخفي
رأس الخادم الذي يراه الماسح الضوئي
cloudflare

ملاحظة خاصة بالماسح الضوئي: alive_content: raw=ok; http=200; via=https_proxy; server=cloudflare

التحقق المباشر من بصمات الأصابع عبر تطبيق «TDS»
سبع بصمات «كيتارو» بالإضافة إلى مقارنة بين المتصفح المتنقل والمتصفح العادي، يتم تشغيلها من الماسح الضوئي PhishDestroy عند فتح هذه اللوحة.
الانتظار

لقطة محفوظة · 3 sources

معلومات النطاق

النطاق
URLScan Verdict اكتمل التحليل score 0 report ↗
الخادم / ASN cloudflare · AS209242 Cloudflare London, LLC
IP Context Cloudflare shared edge origin IP hidden لا تُنسب سمعة Edge-IP إلى هذا المجال.
OTX Tags asciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsertinvisible characters+6 more
مسجّل النطاق GoDaddy US(US)
جهة الإبلاغ عن إساءة الاستخدامabuse@godaddy.com
البحث في قاعدة بيانات WHOISICANN RDAP لـ catalystcapitalharbor.com →
عنوان IP 160.153.0.27 CDN
الموقع الجغرافيUS Tempe, US
الشبكةAS209242 · GoDaddy.com, LLC
يتم إخفاء عنوان IP الأصلي خلف وكيل CDN. تحتوي نتائج IP العكسي لعنوان الحافة على مستأجرين غير مرتبطين؛ يتطلب العثور على المصدر نظام أسماء النطاقات السلبي أو بيانات شفافية الشهادة.
التسجيلتم إنشاؤه 23/09/2025 (364d) Expires 23/09/2026
حالة HTTP200
التفاصيل التقنيةDNS، أسماء المجال البديلة (SAN) في بروتوكول SSL، الطوابع الزمنية
تاريخ أول اكتشاف22/09/2026
IoC Extractionscanned 23/09/20260 wallet · 0 Telegram IoCs
Submitted URLhttp://catalystcapitalharbor.com/
خوادم الأسماءns75.domaincontrol.comns76.domaincontrol.com
MX Records1 aspmx.l.google.com 5 alt1.aspmx.l.google.com 5 alt2.aspmx.l.google.com 10 alt3.aspmx.l.google.com 10 alt4.aspmx.l.google.com
TLS Fingerprint
TLS Observationvalid from 21/08/2026scanned 23/09/2026
Favicon Hash
معرّف القضية
عنوان الصفحة
Catalyst Capital Harbor
شهادة TLS
Valid transport encryption · صادرة عن Google Trust Services / WE1 · valid for 57 days
التقنيات · 9 identified
Detected via Cloudflare Radar · Wappalyzer engine
الإبلاغ عن هذا النطاق أرسل الأدلة وساعد في حماية الآخرين

تحليل VirusTotal

16 / قام موردو الأمان 89 بوضع علامة على هذا المجال
View on VT
Last analyzed
alphaMountain.ai
BitDefender
Chong Lua Dao
CRDF
CyRadar
ESET
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
Lionic
SOCRadar
سوفوس
Viettel Threat Intelligence
VIPRE
Webroot
تحليل أداء الموقع

Google PageSpeed Insights — mobile performance audit of catalystcapitalharbor.com · checked Sep 22, 2026

46
Poor
Performance
FCP
6.45s
First Contentful Paint
LCP
13.46s
Largest Contentful Paint
CLS
0.229
Cumulative Layout Shift
TBT
0ms
Total Blocking Time
SI
7.48s
Speed Index
Powered by Google PageSpeed Insights · Mobile strategy · Scores: 90-100 Good 50-89 Needs Work 0-49 Poor

الأدلة والتقارير الخارجية

لقطة الأدلة المرسلة
Sent: Ledger records: 1 Case ID: PD-20260922-BC7C1E Recipient: abuse@godaddy.com
Page title stored with report: Catalyst Capital Harbor
URLScan evidence VirusTotal evidence URLQuery evidence Screenshot 565.3 KB
PDF notice generated Notice text archived (650 chars)
Abuse notice text as sent to the provider
Policy Violations:
Illegal Activities: Active phishing operation targeting victims
Fraud & Deception: Impersonation of legitimate services
Identity Theft: Collection of credentials under false pretenses
Applicable Laws (Unknown):
International Anti-Cybercrime Regulations
Budapest Convention on Cybercrime
Universal Fraud Prevention Laws
Phishing activities violate international cybercrime conventions and Unknown's domestic fraud laws.
Action Required: This evidence-backed report demonstrates clear violations requiring suspension per your policies. Continued hosting exposes your organization to regulatory scrutiny and potential legal liability.
نظام أسماء النطاقات (DNS) والشبكات
تحسين محركات البحث (SEO) والنطاقات

هل تأثرت بهذا الموقع؟

If credentials were compromised, report immediately. Do not engage with recovery scammers.

إذا أدخلت بيانات اعتماد الحساب أو المعلومات الشخصية أو معلومات الدفع أو قمت بتنزيل ملف من هذا النطاق، فاتخذ إجراءً فوريًا. فيما يلي موارد لمساعدتك في الإبلاغ عن الحادث وحماية نفسك.

اليوروبول
ابحث عن قناة التقارير الرسمية لبلدك في الاتحاد الأوروبي
National police directory
احذروا من المحتالين الذين يزعمون أنهم يساعدون في استرداد الأموال! قد يتصل المجرمون بالضحايا مرة أخرى بينما يتظاهرون بأنهم محققون أو محامون أو وكلاء استرداد. لا تدفع رسومًا مقدمة أو تشارك بيانات الاعتماد. تعرف على المزيد حول الاحتيال في مجال التعافي →

أبلغ السلطات المحلية

حدد بلدك للحصول على الاتصالات الرسمية المتعلقة بالجرائم الإلكترونية أو إنشاء مسودة شكوى →.

دليل 97 دولة
المسودة بمساعدة الذكاء الاصطناعي - تتم معالجة تفاصيل الحادث بواسطة موفر الذكاء الاصطناعي قم بمراجعتها وتقديمها بنفسك

تحقق من أي نطاق

تحليل التهديدات باستخدام قائمة الحظر المخزنة، وWHOIS، وDNS، وأدلة الفحص العامة

امسح الآن

الإبلاغ عن محاولة تصيد احتيالي

أرسل النطاقات المشبوهة إلى قاعدة بيانات التهديدات الخاصة بنا — ساهم في حماية المجتمع

إبلاغ

تحديثات فورية حول التهديدات

تقارير التصيد الاحتيالي الأخيرة وتغييرات التوفر الملحوظة

مراقبة

ابقَ على اطلاع، وابقَ آمنًا

راقب التهديدات في الوقت الفعلي أو اعترض على هذا الإدراج إذا كنت تعتقد أنه إنذار كاذب

تحديثات فورية حول التهديدات الاعتراض على هذا الإعلان
HTML · IFRAME

تضمين هذا التقرير

شارك هذه المعلومات الاستخباراتية المتعلقة بالتهديدات على موقعك الإلكتروني أو مدونتك

embed.html
<iframe
  src="https://phishdestroy.io/ar/embed/domain/catalystcapitalharbor.com"
  title="PhishDestroy threat report for catalystcapitalharbor.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>