Vai al rapporto di sicurezza
Sicurezza del dominio e intelligence sulle minacce
ourbusinessloans.com favicon

ourbusinessloans.com

“Our Business Loans – Quick”

Verdetto di minaccia Critico Punteggio delle prove 90/100
Disponibilità Ultimo attivo conosciuto Ultima osservazione di raggiungibilità memorizzata
Rilevamenti VirusTotal: 8/89 Corrispondenze della blocklist memorizzate: 1 Simulazione del marchio: Unknown Ultimo attivo conosciuto
OTX: 10 refs 22/09/2026 Sconosciuto 1 Report Sent CDN
Actions API
⚠️
Questo dominio è stato segnalato come dannoso
Motori di sicurezza che segnalano un rilevamento: 8. Blocklist pubbliche che segnalano una corrispondenza: 1. Prestare estrema cautela: non inserire credenziali o informazioni personali.
Riepilogo del rapporto

ourbusinessloans.com — Ultimo attivo conosciuto (HTTP 200). Simulazione del marchio: Unknown; Tipo di truffa: Impersonation. Riepilogo delle prove: VirusTotal 8/89 (alphaMountain.ai, BitDefender, Forcepoint ThreatSeeker, Fortinet, G-Data); URLQuery 2 det.; 1 external blocklist match (CryptoFirewall); PhishDestroy score 90/100. Registrar: GoDaddy.

L’analisi dettagliata di PhishDestroy AI resta in inglese per preservare il rapporto forense originale.

Riepilogo delle prove

CRITICO
Punteggio
90/100

Assessment
Stored evidence for ourbusinessloans.com: VirusTotal recorded 8 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for ourbusinessloans.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 8 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for ourbusinessloans.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains ourbusinessloans.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed ourbusinessloans.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2021-07-29. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 160.153.0.178 as the observed address in this record. The registration date for ourbusinessloans.com is recorded as 2021-07-29. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The ourbusinessloans.com record states that VirusTotal recorded 8 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 160.153.0.178. The supported conclusion is bounded to the exact stored observations for ourbusinessloans.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to ourbusinessloans.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain ourbusinessloans.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to ourbusinessloans.com. The stored record does not justify extending that rule to 160.153.0.178 or to other infrastructure records.

VirusTotal
VirusTotal
8 det.
URLQuery
URLQuery
2 det.
OTX references
URLScan
URLScan
Certificato TLS
Google Trust Services / WE1
Età
5.2 yr
Stato osservato
Ultimo attivo conosciuto 200
PhishDestroy
Elenco da eliminare
Presente
Reports Sent
1
Copertura dei dati VirusTotal 8 / 89 URLQuery 2 det. OTX 10 community references CF Radar scan completed URLScan capture rapporto memorizzato URLScan verdict Analisi completata TLS valid certificate, 80d WHOIS 63 mo old Screenshot 3 captures · 2 sources

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as alive pointing to IP 160.153.0.178.

Pipeline di risposta alle minacce

Scoperta
Checks
Reports
Disponibilità
13/14
Sent Report Recorded
Stored sent-report record for registrar GoDaddy.com, LLC, hosting provider, 1 abuse contact
abuse@godaddy.com
22/09/2026

Stato della lista di blocco pubblica

Analisi di rilevamento ed evasione

Sospetto cloaking: i titoli dello scanner e quelli dei visitatori non corrispondono

Non ancora scansionato Non è stata ancora rilevata alcuna differenza tra crawler e browser

Osservazioni archiviate relative al confronto tra crawler e browser per questo host, oltre a una verifica in tempo reale delle impronte digitali per i sistemi di distribuzione del traffico in stile Keitaro.

Flag di occultamento memorizzato
Non ancora scansionato
Ultima scansione di occultamento
Intestazione del server rilevata dallo scanner
cloudflare

Nota dello scanner: alive_content: raw=ok; http=200; via=https_proxy; server=cloudflare

Titolo visualizzato sullo scanner di sicurezzaOur Business Loans – Quick & Flexible Business Loans
Titolo visualizzato agli utenti che visitano il sito tramite browserOur Business Loans – Quick
Verifica delle impronte digitali in tempo reale TDS
Sette impronte digitali di Keitaro più un confronto tra crawler e browser, eseguiti dallo scanner PhishDestroy quando questa finestra è aperta.
In attesa

Acquisizione salvata · 3 sources

Analisi dei domini

Dominio
URLScan Verdict Analisi completata score 0 report ↗
Server / ASN cloudflare · AS209242 Cloudflare London, LLC
IP Context Cloudflare shared edge origin IP hidden La reputazione Edge-IP non è attribuita a questo dominio.
OTX Tags asciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsertinvisible characters+6 more
Registrar GoDaddy US(US)
Indirizzo IP 160.153.0.178 CDN
PosizioneUS Tempe, US
ReteAS209242 · GoDaddy.com, LLC
L'IP di origine è nascosto dietro un proxy CDN. I risultati dell'IP inverso per l'indirizzo edge contengono tenant non correlati; la ricerca dell'origine richiede DNS passivo o dati di trasparenza del certificato.
RegistrazioneCreato 29/07/2021 Expires 29/07/2027
Stato HTTP200
Dettagli tecniciDNS, SAN SSL, timestamp
Rilevato per la prima volta22/09/2026
DOM Analysisanalyzed 23/09/2026score 88/100
IoC Extractionscanned 23/09/20260 wallet · 0 Telegram IoCs
Submitted URLhttp://ourbusinessloans.com/
Nameserverns13.domaincontrol.comns14.domaincontrol.com
MX Records1 aspmx.l.google.com 5 alt2.aspmx.l.google.com 5 alt1.aspmx.l.google.com 10 alt4.aspmx.l.google.com 10 alt3.aspmx.l.google.com
TLS Fingerprint
TLS Observationvalid from 14/09/2026scanned 23/09/2026
Favicon Hash
ID del caso
Titolo della pagina
Our Business Loans – Quick
Certificato TLS
Valid transport encryption · Emesso da Google Trust Services / WE1 · valid for 80 days
Tecnologie · 12 identified
Detected via Cloudflare Radar · Wappalyzer engine
Segnala questo dominio Invia le prove e contribuisci a proteggere gli altri

Analisi di VirusTotal

8 / I fornitori di sicurezza 89 hanno contrassegnato questo dominio
View on VT
Last analyzed
alphaMountain.ai
BitDefender
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
SOCRadar
Sophos

Dati e relazioni esterne

Istantanea delle prove inviate
Sent: Ledger records: 1 Case ID: PD-20260922-510AF7 Recipient: abuse@godaddy.com
Page title stored with report: Our Business Loans – Quick & Flexible Business Loans
URLScan evidence VirusTotal evidence URLQuery evidence Screenshot 582.6 KB
PDF notice generated Notice text archived (650 chars)
Abuse notice text as sent to the provider
Policy Violations:
Illegal Activities: Active phishing operation targeting victims
Fraud & Deception: Impersonation of legitimate services
Identity Theft: Collection of credentials under false pretenses
Applicable Laws (Unknown):
International Anti-Cybercrime Regulations
Budapest Convention on Cybercrime
Universal Fraud Prevention Laws
Phishing activities violate international cybercrime conventions and Unknown's domestic fraud laws.
Action Required: This evidence-backed report demonstrates clear violations requiring suspension per your policies. Continued hosting exposes your organization to regulatory scrutiny and potential legal liability.

Questo sito ti ha influenzato in qualche modo?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

Se hai inserito credenziali dell'account, informazioni personali o di pagamento oppure hai scaricato un file da questo dominio, agisci immediatamente. Di seguito sono riportate le risorse per aiutarti a segnalare l'incidente e proteggerti.

Europol
Trova il canale di segnalazione ufficiale per il tuo paese dell'UE
National police directory
Attenzione ai truffatori che promettono il recupero dei fondi! I criminali possono contattare nuovamente le vittime fingendo di essere investigatori, avvocati o agenti di recupero. Non pagare commissioni anticipate né condividere credenziali. Scopri di più sulle frodi relative ai sussidi di recupero →

Segnalalo alle autorità locali

Seleziona il tuo Paese per ottenere contatti ufficiali del crimine informatico o creare una bozza di reclamo →.

Elenco di 97 paesi
Bozza assistita dall'intelligenza artificiale: i dettagli dell'incidente vengono elaborati dal fornitore di intelligenza artificiale Controllalo e invialo tu stesso

Verifica qualsiasi dominio

Analisi delle minacce utilizzando blocklist archiviate, WHOIS, DNS e prove di scansione pubblica

Scansiona ora

Segnala un tentativo di phishing

Segnala i domini sospetti al nostro database delle minacce — proteggi la comunità

Segnala

Feed in tempo reale sulle minacce

Segnalazioni recenti di phishing e modifiche osservate della disponibilità

Monitora

Rimani informato, rimani al sicuro

Controlla le minacce in tempo reale oppure contesta questa segnalazione se ritieni che si tratti di un falso positivo

Feed in tempo reale sulle minacce Contesta questo annuncio
HTML · IFRAME

Incorpora questo rapporto

Condividi queste informazioni sulle minacce sul tuo sito web o sul tuo blog

embed.html
<iframe
  src="https://phishdestroy.io/it/embed/domain/ourbusinessloans.com"
  title="PhishDestroy threat report for ourbusinessloans.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>