ivvvaaannaaalaaawiiiiifamilly[.]blogspot[.]com

Analysis of the domain ivvvaaannaaalaaawiiiiifamilly.blogspot.com indicates it is actively associated with a high-risk phishing campaign as of July 30, 2026. The domain is registered through Google LLC, consistent with Blogspot subdomains, and resolves to the IP address 142.250.154.132, which is part of Google's infrastructure. This infrastructure choice is frequently exploited by threat actors to lend superficial legitimacy to phishing pages, as Google-hosted domains often bypass initial reputation checks. The domain appears on two security blocklists: PhishDestroy and OpenPhish, both of which are recognized for identifying active phishing threats.

Detection by these platforms suggests the domain is actively serving malicious content or redirecting users to fraudulent pages. VirusTotal scanning reveals that 14 out of 91 security vendors flag the domain as malicious, further corroborating its classification as a phishing site. The absence of configured nameservers (NS_NOT_FOUND) is atypical for legitimate domains and may indicate an attempt to obscure ownership or evade automated detection systems. No specific brand impersonation or scam category is identified in the available data, and the exact content of the site remains unanalyzed.

However, the combination of blocklist presence, detection by multiple security vendors, and the use of a Blogspot subdomain strongly supports the classification of this domain as part of a phishing operation. Defenders are advised to block the domain at the network level and monitor for related subdomains or IPs within Google's infrastructure. Given the domain's active status and high-risk classification, users should be cautioned against accessing it, and security teams should treat any interaction with it as a potential compromise.