सुरक्षा रिपोर्ट पर जाएँ
डोमेन सुरक्षा और ख़तरे की आसूचना
elevatecapitalrush.com favicon

elevatecapitalrush.com

“Elevate Capital Rush”

धमकी भरा फैसला गंभीर 98/100 साक्ष्य स्कोर
उपलब्धता अंतिम ज्ञात सक्रिय नवीनतम संग्रहीत रीचैबिलिटी अवलोकन
वायरस का कुल पता लगाना: 10/89 संग्रहीत ब्लॉकलिस्ट मिलान: 1 ब्रांड प्रतिरूपण: Unknown अंतिम ज्ञात सक्रिय
OTX: 10 refs 22/09/2026 अज्ञात 1 Report Sent CDN
Actions एपीआई
⚠️
इस डोमेन को दुर्भावनापूर्ण के रूप में चिह्नित किया गया है।
सुरक्षा इंजन एक पहचान की रिपोर्ट कर रहे हैं: 10। किसी मैच की रिपोर्ट करने वाली सार्वजनिक ब्लॉक सूचियाँ: 1। अत्यधिक सावधानी बरतें - क्रेडेंशियल या व्यक्तिगत जानकारी दर्ज न करें।
रिपोर्ट सारांश

elevatecapitalrush.com — अंतिम ज्ञात सक्रिय (HTTP 200). ब्रांड प्रतिरूपण: Unknown. साक्ष्य सारांश: VirusTotal 10/89 (alphaMountain.ai, BitDefender, Chong Lua Dao, Forcepoint ThreatSeeker, Fortinet); URLQuery 3 det.; URLScan capture; 1 external blocklist match (CryptoFirewall); PhishDestroy score 98/100. रजिस्ट्रार: GoDaddy.

मूल फॉरेंसिक रिकॉर्ड सुरक्षित रखने के लिए नीचे का विस्तृत PhishDestroy AI विश्लेषण अंग्रेज़ी में रखा गया है।

साक्ष्य सारांश

आलोचनात्मक
स्कोर
98/100

Assessment
Stored evidence for elevatecapitalrush.com: VirusTotal recorded 10 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for elevatecapitalrush.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 10 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for elevatecapitalrush.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains elevatecapitalrush.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed elevatecapitalrush.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2025-09-09. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 160.153.0.129 as the observed address in this record. The registration date for elevatecapitalrush.com is recorded as 2025-09-09. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The elevatecapitalrush.com record states that VirusTotal recorded 10 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 160.153.0.129. The supported conclusion is bounded to the exact stored observations for elevatecapitalrush.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to elevatecapitalrush.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain elevatecapitalrush.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to elevatecapitalrush.com. The stored record does not justify extending that rule to 160.153.0.129 or to other infrastructure records.

VirusTotal
VirusTotal
10 det.
URLQuery
यूआरएलक्वेरी
3 det.
OTX references
URLScan
यूआरएलस्कैन
ScamAdviser
Scamadviser
80/100Likely Safe
TLS प्रमाणपत्र
Google Trust Services / WE1
आयु
1 yr
देखी गई स्थिति
अंतिम ज्ञात सक्रिय 200
PhishDestroy
विनाश सूची
सूचीबद्ध
Reports Sent
1
डेटा कवरेज VirusTotal 10 / 89 यूआरएलक्वेरी 3 det. ओटीएक्स 10 community references सीएफ रडार scan completed URLScan capture संग्रहित रिपोर्ट TLS valid certificate, 57d कौन है 13 mo old स्क्रीनशॉट 3 captures · 2 sources Scamadviser 80/100

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as alive pointing to IP 160.153.0.129.

धमकी प्रतिक्रिया पाइपलाइन

खोज
Checks
Reports
उपलब्धता
12/13
Sent Report Recorded
Stored sent-report record for registrar GoDaddy.com, LLC, hosting provider, 1 abuse contact
abuse@godaddy.com
22/09/2026

सार्वजनिक ब्लॉकलिस्ट स्थिति

खोज-परहेज़ विश्लेषण

क्लोकिंग और ट्रैफ़िक-वितरण जाँच

अभी तक स्कैन नहीं किया गया अभी तक क्रॉलर और ब्राउज़र के बीच कोई अंतर दर्ज नहीं किया गया है।

इस होस्ट के लिए संग्रहीत क्रॉलर-बनाम-ब्राउज़र अवलोकन, साथ ही केइतारो-शैली ट्रैफ़िक वितरण प्रणालियों के लिए लाइव फिंगरप्रिंट जांच।

संग्रहीत छुपाने वाला झंडा
अभी तक स्कैन नहीं किया गया
अंतिम छुपाने का स्कैन
स्कैनर द्वारा देखा गया सर्वर हेडर
cloudflare

स्कैनर नोट: alive_content: raw=ok; http=200; via=https_proxy; server=cloudflare

TDS लाइव फिंगरप्रिंट जांच
सात केइतारो फिंगरप्रिंट्स और एक क्रॉलर-बनाम-ब्राउज़र तुलना, जब यह पैनल खुला हो तो PhishDestroy स्कैनर से चलाया जाता है।
इंतज़ार

सहेजा गया कैप्चर · 3 sources

डोमेन इंटेलिजेंस

डोमेन
सर्वर / ASN AS209242 Cloudflare London, LLC
IP Context Cloudflare shared edge origin IP hidden एज-आईपी प्रतिष्ठा इस डोमेन के लिए जिम्मेदार नहीं है।
OTX Tags asciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsertinvisible characters+6 more
रजिस्ट्रार GoDaddy US(US)
दुरुपयोग संपर्कabuse@godaddy.com
IP पता 160.153.0.129 CDN
भौगोलिक स्थानUS Tempe, US
नेटवर्कAS209242 · GoDaddy.com, LLC
रिवर्स IPviewdns.info → rapiddns.io →
मूल आईपी सीडीएन प्रॉक्सी के पीछे छिपा हुआ है। किनारे के पते के लिए रिवर्स-आईपी परिणामों में असंबंधित किरायेदार शामिल हैं; मूल का पता लगाने के लिए निष्क्रिय DNS या प्रमाणपत्र-पारदर्शिता डेटा की आवश्यकता होती है।
पंजीकरणनिर्मित 09/09/2025 Expires 09/09/2027
HTTP स्थिति200
तकनीकी विवरणडीएनएस, एसएसएल एसएएन, टाइमस्टैम्प
पहली बार पता चला22/09/2026
DOM Analysisanalyzed 23/09/2026score 98/1001 brand signal
Submitted URLhttp://elevatecapitalrush.com/
नेमसर्वरns47.domaincontrol.comns48.domaincontrol.com
MX Records1 aspmx.l.google.com 5 alt1.aspmx.l.google.com 5 alt2.aspmx.l.google.com 10 alt3.aspmx.l.google.com 10 alt4.aspmx.l.google.com
TLS Fingerprint
TLS Observationvalid from 21/08/2026scanned 23/09/2026
Favicon Hash
केस आईडी
पेज शीर्षक
Elevate Capital Rush
Impersonates
Google
TLS प्रमाणपत्र
Valid transport encryption · जारीकर्ता Google Trust Services / WE1 · valid for 57 days
तकनीकें · 10 identified
Detected via Cloudflare Radar · Wappalyzer engine
इस डोमेन की रिपोर्ट करें सबूत जमा करें और दूसरों की सुरक्षा में मदद करें

वायरसटोटल विश्लेषण

10 / 89 सुरक्षा विक्रेताओं ने इस डोमेन को चिह्नित किया
View on VT
Last analyzed
alphaMountain.ai
BitDefender
Chong Lua Dao
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
SOCRadar
सोफोस
Viettel Threat Intelligence

साक्ष्य और बाहरी रिपोर्टें

भेजे गए प्रमाण का स्नैपशॉट
Sent: Ledger records: 1 Case ID: PD-20260922-FE91AA Recipient: abuse@godaddy.com
Page title stored with report: Elevate Capital Rush
URLScan evidence VirusTotal evidence URLQuery evidence Screenshot 521.4 KB
PDF notice generated Notice text archived (650 chars)
Abuse notice text as sent to the provider
Policy Violations:
Illegal Activities: Active phishing operation targeting victims
Fraud & Deception: Impersonation of legitimate services
Identity Theft: Collection of credentials under false pretenses
Applicable Laws (Unknown):
International Anti-Cybercrime Regulations
Budapest Convention on Cybercrime
Universal Fraud Prevention Laws
Phishing activities violate international cybercrime conventions and Unknown's domestic fraud laws.
Action Required: This evidence-backed report demonstrates clear violations requiring suspension per your policies. Continued hosting exposes your organization to regulatory scrutiny and potential legal liability.

क्या आप इस साइट से प्रभावित हुए?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

यदि आपने खाता क्रेडेंशियल, व्यक्तिगत या भुगतान जानकारी दर्ज की है, या इस डोमेन से कोई फ़ाइल डाउनलोड की है, तो तुरंत कार्रवाई करें। घटना की रिपोर्ट करने और अपनी सुरक्षा करने में आपकी सहायता के लिए नीचे संसाधन दिए गए हैं।

यूरोपोल
अपने ईयू देश के लिए आधिकारिक रिपोर्टिंग चैनल ढूंढें
National police directory
रिकवरी ठगों से सावधान रहें! अपराधी जांचकर्ता, वकील या रिकवरी एजेंट होने का नाटक करते हुए पीड़ितों से दोबारा संपर्क कर सकते हैं। अग्रिम शुल्क का भुगतान न करें या क्रेडेंशियल साझा न करें। रिकवरी धोखाधड़ी के बारे में और जानें →

अपने स्थानीय अधिकारियों को रिपोर्ट करें

आधिकारिक साइबर अपराध संपर्क, या एक शिकायत ड्राफ्ट बनाएं → प्राप्त करने के लिए अपना देश चुनें।

97-देश निर्देशिका
एआई-सहायता प्राप्त ड्राफ्ट - घटना विवरण एआई प्रदाता द्वारा संसाधित किया जाता है इसकी स्वयं समीक्षा करें और सबमिट करें

किसी भी डोमेन की जाँच करें

संग्रहीत ब्लॉकलिस्ट, WHOIS, DNS और सार्वजनिक स्कैन साक्ष्य का उपयोग करके खतरे का विश्लेषण

अभी स्कैन करें

फ़िशिंग की रिपोर्ट करें

संदिग्ध डोमेन हमारे थ्रेट डेटाबेस में जमा करें — समुदाय की सुरक्षा करें

रिपोर्ट करें

सीधा खतरा फीड

हाल की फ़िशिंग रिपोर्टें और उपलब्धता में परिवर्तन देखे गए

निगरानी करें

जानकारी में रहें, सुरक्षित रहें

लाइव खतरों की निगरानी करें या यदि आपको लगता है कि यह एक गलत सकारात्मक है तो इस लिस्टिंग को चुनौती दें।

सीधा खतरा फीड इस लिस्टिंग के खिलाफ अपील करें
HTML · IFRAME

इस रिपोर्ट को एम्बेड करें

इस थ्रेट इंटेलिजेंस को अपनी वेबसाइट या ब्लॉग पर साझा करें।

embed.html
<iframe
  src="https://phishdestroy.io/hi/embed/domain/elevatecapitalrush.com"
  title="PhishDestroy threat report for elevatecapitalrush.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>