Aller au rapport de sécurité
Sécurité des domaines et renseignements sur les menaces
harboradvancefunding.com favicon

harboradvancefunding.com

“Harbor Advance Funding”

Verdict de menace Critique 100/100 score de preuve
Disponibilité Dernier actif connu Dernière observation d'accessibilité stockée
Détections VirusTotal : 16/89 Correspondances de la liste de blocage stockée : 1 Usurpation de l'identité de la marque : Unknown Dernier actif connu
OTX: 11 refs 22/09/2026 Inconnu 1 Report Sent CDN
Actions API
⚠️
Ce domaine a été signalé comme malveillant
Moteurs de sécurité signalant une détection : 16. Listes de blocage publiques signalant une correspondance : 1. Faites preuve d’une extrême prudence – ne saisissez pas d’informations d’identification ou d’informations personnelles.
Résumé du rapport

harboradvancefunding.com — Dernier actif connu (HTTP 200). Usurpation de l'identité de la marque : Unknown; Type d'arnaque : Impersonation. Résumé des preuves: VirusTotal 16/89 (alphaMountain.ai, Bfore.Ai PreCrime, BitDefender, Chong Lua Dao, CyRadar); URLQuery 3 det.; 1 external blocklist match (CryptoFirewall); PhishDestroy score 100/100. Bureau d’enregistrement: GoDaddy.

L’analyse détaillée de PhishDestroy AI reste en anglais afin de préserver le relevé forensique original.

Résumé des preuves

CRITIQUE
Score
100/100

Assessment
Stored evidence for harboradvancefunding.com: VirusTotal recorded 16 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for harboradvancefunding.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 16 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for harboradvancefunding.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains harboradvancefunding.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed harboradvancefunding.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2025-01-28. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 160.153.0.17 as the observed address in this record. The registration date for harboradvancefunding.com is recorded as 2025-01-28. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The harboradvancefunding.com record states that VirusTotal recorded 16 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 160.153.0.17. The supported conclusion is bounded to the exact stored observations for harboradvancefunding.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to harboradvancefunding.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain harboradvancefunding.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to harboradvancefunding.com. The stored record does not justify extending that rule to 160.153.0.17 or to other infrastructure records.

VirusTotal
VirusTotal
16 det.
URLQuery
URLQuery
3 det.
OTX references
URLScan
URLScan
Certificat TLS
Google Trust Services / WE1
Âge
1.6 yr
Statut observé
Dernier actif connu 200
PhishDestroy
DestroyList
Répertorié
Reports Sent
1
Couverture des données VirusTotal 16 / 89 URLQuery 3 det. OTX 11 community references CF Radar scan completed URLScan capture rapport stocké URLScan verdict Analyse terminée TLS valid certificate, 50d WHOIS 20 mo old Capture d'écran 3 captures · 2 sources

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as alive pointing to IP 160.153.0.17.

Processus de réponse aux menaces Pipeline

Découverte
Checks
Reports
Disponibilité
13/14
Sent Report Recorded
Stored sent-report record for registrar GoDaddy.com, LLC, hosting provider, 1 abuse contact
abuse@godaddy.com
22/09/2026

Statut de la liste de blocage publique

Analyse de la détection et de l'évasion

Vérification du cloaking et de la répartition du trafic

Pas encore numérisé Aucune différence entre les robots d'indexation et les navigateurs n'a encore été constatée

Enregistrement des observations « crawler contre navigateur » pour cet hôte, ainsi qu'une vérification en temps réel des empreintes numériques pour les systèmes de répartition du trafic de type Keitaro.

Indicateur de camouflage enregistré
Pas encore numérisé
Dernier scan de camouflage
En-tête du serveur détecté par le scanner
cloudflare

Note relative à la numérisation: alive_content: raw=ok; http=200; via=https_proxy; server=cloudflare

Vérification en direct des empreintes digitales d'TDS
Sept empreintes Keitaro ainsi qu’une comparaison entre robot d’indexation et navigateur, générées par le scanner PhishDestroy lorsque ce panneau est ouvert.
En attente

Capture enregistrée · 3 sources

Informations sur les domaines

Domaine
URLScan Verdict Analyse terminée score 0 report ↗
Serveur / ASN cloudflare · AS209242 Cloudflare London, LLC
IP Context Cloudflare shared edge origin IP hidden La réputation Edge-IP n’est pas attribuée à ce domaine.
OTX Tags activecampaignasciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsert+6 more
Bureau d’enregistrement GoDaddy US(US)
Adresse IP 160.153.0.17 CDN
LocalisationUS Tempe, US
RéseauAS209242 · GoDaddy.com, LLC
L'adresse IP d'origine est cachée derrière un proxy CDN. Les résultats d’IP inversé pour l’adresse périphérique contiennent des locataires non liés ; trouver l’origine nécessite un DNS passif ou des données de transparence des certificats.
EnregistrementCréé 28/01/2025 Expires 28/01/2027
Statut HTTP200
Détails techniquesDNS, SAN SSL, horodatages
Première détection22/09/2026
DOM Analysisanalyzed 23/09/2026score 98/100
IoC Extractionscanned 23/09/20260 wallet · 0 Telegram IoCs
Submitted URLhttp://harboradvancefunding.com/
Serveurs de nomsns23.domaincontrol.comns24.domaincontrol.com
MX Records1 aspmx.l.google.com 5 alt2.aspmx.l.google.com 5 alt1.aspmx.l.google.com 10 alt3.aspmx.l.google.com 10 alt4.aspmx.l.google.com
TLS Fingerprint
TLS Observationvalid from 14/08/2026scanned 23/09/2026
Favicon Hash
ID du dossier
Titre de la page
Harbor Advance Funding
Certificat TLS
Valid transport encryption · Émis par Google Trust Services / WE1 · valid for 50 days
Technologies · 9 identified
Detected via Cloudflare Radar · Wappalyzer engine
Signaler ce domaine Envoyez des éléments de preuve et contribuez à protéger les autres

Analyse VirusTotal

16 / Les fournisseurs de sécurité 89 ont signalé ce domaine
View on VT
Last analyzed
alphaMountain.ai
Bfore.Ai PreCrime
BitDefender
Chong Lua Dao
CyRadar
ESET
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
Lionic
SOCRadar
Sophos
Viettel Threat Intelligence
VIPRE
Webroot

Données factuelles et rapports externes

Instantané des preuves transmises
Sent: Ledger records: 1 Case ID: PD-20260922-3D9C70 Recipient: abuse@godaddy.com
Page title stored with report: Harbor Advance Funding
URLScan evidence VirusTotal evidence URLQuery evidence Screenshot 298.0 KB
PDF notice generated Notice text archived (650 chars)
Abuse notice text as sent to the provider
Policy Violations:
Illegal Activities: Active phishing operation targeting victims
Fraud & Deception: Impersonation of legitimate services
Identity Theft: Collection of credentials under false pretenses
Applicable Laws (Unknown):
International Anti-Cybercrime Regulations
Budapest Convention on Cybercrime
Universal Fraud Prevention Laws
Phishing activities violate international cybercrime conventions and Unknown's domestic fraud laws.
Action Required: This evidence-backed report demonstrates clear violations requiring suspension per your policies. Continued hosting exposes your organization to regulatory scrutiny and potential legal liability.

Ce site vous a-t-il affecté ?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

Si vous avez saisi des informations d'identification de compte, des informations personnelles ou de paiement, ou téléchargé un fichier à partir de ce domaine, agissez immédiatement. Vous trouverez ci-dessous des ressources pour vous aider à signaler l'incident et à vous protéger.

Europol
Trouvez le canal de signalement officiel pour votre pays de l'UE
National police directory
Méfiez-vous des escrocs qui prétendent vous aider à récupérer vos biens ! Les criminels peuvent recontacter leurs victimes tout en se faisant passer pour des enquêteurs, des avocats ou des agents de recouvrement. Ne payez pas de frais initiaux et ne partagez pas vos informations d'identification. En savoir plus sur la fraude liée aux aides à la reprise →

Signalez-le à vos autorités locales

Sélectionnez votre pays pour obtenir contacts officiels en matière de cybercriminalité ou créer un projet de plainte →.

Annuaire de 97 pays
Brouillon assisté par l'IA : les détails de l'incident sont traités par le fournisseur d'IA Examinez-le et soumettez-le vous-même

Vérifier n'importe quel domaine

Analyse des menaces à l'aide de listes de blocage stockées, de WHOIS, de DNS et de preuves d'analyse publique

Scanner maintenant

Signaler une tentative d'hameçonnage

Signalez les domaines suspects à notre base de données des menaces — protégez la communauté

Signaler

Flux d'alertes en temps réel

Rapports de phishing récents et changements de disponibilité observés

Surveiller

Restez informés, restez en sécurité

Surveillez les menaces en temps réel ou signalez cette alerte si vous pensez qu'il s'agit d'un faux positif

Flux d'alertes en temps réel Contester cette annonce
HTML · IFRAME

Intégrer ce rapport

Partagez ces informations sur les menaces sur votre site web ou votre blog

embed.html
<iframe
  src="https://phishdestroy.io/fr/embed/domain/harboradvancefunding.com"
  title="PhishDestroy threat report for harboradvancefunding.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>