Ir al informe de seguridad
Seguridad de dominio e inteligencia sobre amenazas
yourlocfunding.com favicon

yourlocfunding.com

“Your Loc Funding”

Veredicto de amenaza Crítico Puntuación de evidencia 100/100
Disponibilidad Último activo conocido Última observación de accesibilidad almacenada
VirusTotal detecciones: 15/89 Coincidencias de la lista de bloqueo almacenadas: 1 Suplantación de marca: Unknown Último activo conocido
OTX: 12 refs 22/09/2026 Desconocido 1 Report Sent CDN
Actions API
⚠️
Este dominio ha sido señalado como malicioso
Motores de seguridad que informan una detección: 15. Listas de bloqueo públicas que informan una coincidencia: 1. Tenga extrema precaución: no ingrese credenciales o información personal.
Resumen del informe

yourlocfunding.com — Último activo conocido (HTTP 200). Suplantación de marca: Unknown; Tipo de estafa: Impersonation. Resumen de las pruebas: VirusTotal 15/89 (alphaMountain.ai, BitDefender, Chong Lua Dao, CyRadar, ESET); URLQuery 3 det.; URLScan capture; 1 external blocklist match (CryptoFirewall); PhishDestroy score 100/100. Registrador: GoDaddy.

El análisis detallado de PhishDestroy AI se mantiene en inglés para conservar el registro forense original.

Resumen de las pruebas

CRÍTICO
Puntuación
100/100

Assessment
Stored evidence for yourlocfunding.com: VirusTotal recorded 15 detections among 89 scanners on 2026-09-22. That ratio reproduces the stored check in its original units and is not converted into another measure. CryptoFirewall appear as named external blocklist observations for yourlocfunding.com. Each item in this report remains at the scope supplied by its dated source record.

Detection Evidence
VirusTotal records 15 detections among 89 scanners in the stored snapshot dated 2026-09-22. The numerator describes scanners that produced detections, while the denominator describes scanners included in that check. The reverse order would materially alter the stored result. The VirusTotal snapshot dated 2026-09-22 supplies no common rationale covering the included scanners, and this report adds none. A later VirusTotal snapshot may contain different values, so any comparison should preserve the exact ratio and date of each snapshot.

Source Context
CryptoFirewall are recorded as named external blocklist observations for yourlocfunding.com in the snapshot dated 2026-09-22. The stored CryptoFirewall blocklist records supply names and entries, but they supply no shared method or common rationale. PhishDestroy’s catalogue also contains yourlocfunding.com as a publisher record. That PhishDestroy record is counted separately from the CryptoFirewall external blocklist observations. This separation keeps the origin of every entry visible and prevents a single stored item from being counted again under another source label.

Reachability and Timeline
The record first observed yourlocfunding.com on 2026-09-22. The CryptoFirewall blocklist snapshot is dated 2026-09-22 and remains a separate event in the stored timeline. The registration date is separately recorded as 2024-10-18. Each timestamp qualifies only the adjacent observation in this timeline. Later collection results should be compared with these dated values without replacing the earlier snapshot.

Registration and Infrastructure
The source stores 160.153.0.202 as the observed address in this record. The registration date for yourlocfunding.com is recorded as 2024-10-18. These fields preserve registration, network, and certificate context stored in this record. The report preserves each label and number as a separate source value instead of combining them into an invented aggregate. Keeping the fields separate leaves every infrastructure value traceable to the record that supplied it.

Conclusion
The yourlocfunding.com record states that VirusTotal recorded 15 detections among 89 scanners on 2026-09-22. CryptoFirewall remain named blocklist observations from the snapshot dated 2026-09-22. PhishDestroy remains a separate publisher catalogue entry in the stored record. The observed address field in this record contains 160.153.0.202. The supported conclusion is bounded to the exact stored observations for yourlocfunding.com. Any statement beyond those source values would require additional dated material.

Recommended Actions
Avoid submitting sensitive information to yourlocfunding.com during review. Use a known service address obtained separately from this report for any necessary access. Defenders can retain yourlocfunding.com as an exact indicator and preserve relevant DNS, proxy, and endpoint records. Compare later VirusTotal snapshots and CryptoFirewall blocklist records with the dated values above instead of replacing them. Keep each later observation with its source date so changes remain visible during follow-up review. If a defensive rule is needed, keep its scope to yourlocfunding.com. The stored record does not justify extending that rule to 160.153.0.202 or to other infrastructure records.

VirusTotal
VirusTotal
15 det.
URLQuery
URLQuery
3 det.
OTX references
URLScan
URLScan
Certificado TLS
Google Trust Services / WE1
Edad
1.9 yr
Estado observado
Último activo conocido 200
PhishDestroy
DestroyList
Incluido
Reports Sent
1
Cobertura de los datos VirusTotal 15 / 89 URLQuery 3 det. OTX 12 community references CF Radar scan completed URLScan capture informe almacenado TLS valid certificate, 51d WHOIS 23 mo old Captura de pantalla 3 captures · 2 sources

Forensic History & Detection Timeline

This timeline displays historical security and status checkpoints observed by the PhishDestroy automated monitoring network. It records domain lifecycle updates, scanner changes, and threat telemetry over time.
  1. Threat First Observed Sep 22, 2026 · 22:41 UTC
    Domain ingestion complete. Initial state is marked as unknown pointing to IP 160.153.0.202.

Proceso de respuesta ante amenazas Pipeline

Descubrimiento
Checks
Reports
Disponibilidad
12/13
Sent Report Recorded
Stored sent-report record for registrar GoDaddy.com, LLC, hosting provider, 1 abuse contact
abuse@godaddy.com
22/09/2026

Estado de la lista de bloqueados pública

Análisis de detección y evasión

Comprobación del enmascaramiento y la distribución del tráfico

Aún no se ha escaneado Aún no se ha registrado ninguna diferencia entre los rastreadores y los navegadores

Observaciones almacenadas de rastreadores frente a navegadores para este servidor, además de una comprobación en tiempo real de la huella digital para sistemas de distribución de tráfico al estilo Keitaro.

Indicador de camuflaje almacenado
Aún no se ha escaneado
Último escaneo de camuflaje
Encabezado del servidor detectado por el escáner
cloudflare

Nota del escáner: alive_content: raw=ok; http=200; via=https_proxy; server=cloudflare

Comprobación de huellas dactilares en directo en TDS
Siete huellas de Keitaro, además de una comparación entre el rastreador y el navegador, que se ejecutan desde el escáner PhishDestroy cuando este panel está abierto.
Esperando

Captura guardada · 3 sources

Inteligencia de dominios

Dominio
Servidor / ASN AS209242 Cloudflare London, LLC
IP Context Cloudflare shared edge origin IP hidden La reputación de Edge-IP no se atribuye a este dominio.
OTX Tags activecampaignasciiascii smugglingblueskycapitaldefenderelevateemail obfuscationexpressfebruaryfilehashmd5filehashsha256fortrainsert+6 more
Registrador GoDaddy US(US)
Dirección IP 160.153.0.202 CDN
UbicaciónUS Tempe, US
RedAS209242 · GoDaddy.com, LLC
La IP de origen está oculta detrás de un proxy CDN. Los resultados de IP inversa para la dirección perimetral contienen inquilinos no relacionados; encontrar el origen requiere DNS pasivo o datos de transparencia de certificado.
RegistroCreado 18/10/2024 Expires 18/10/2026
Estado HTTP200
Detalles técnicosDNS, SAN de SSL, marcas de tiempo
Primera detección22/09/2026
DOM Analysisanalyzed 23/09/2026score 98/100
Submitted URLhttp://yourlocfunding.com/
Servidores de nombresns65.domaincontrol.comns66.domaincontrol.com
MX Records1 aspmx.l.google.com 5 alt2.aspmx.l.google.com 5 alt1.aspmx.l.google.com 10 alt4.aspmx.l.google.com 10 alt3.aspmx.l.google.com
TLS Fingerprint
TLS Observationvalid from 16/08/2026scanned 23/09/2026
Favicon Hash
ID del caso
Título de la página
Your Loc Funding
Certificado TLS
Valid transport encryption · Emitido por Google Trust Services / WE1 · valid for 51 days
Tecnologías · 9 identified
Detected via Cloudflare Radar · Wappalyzer engine
Denunciar este dominio Envía pruebas y ayuda a proteger a los demás

Análisis de VirusTotal

15 / Los proveedores de seguridad de 89 marcaron este dominio
View on VT
Last analyzed
alphaMountain.ai
BitDefender
Chong Lua Dao
CyRadar
ESET
Forcepoint ThreatSeeker
Fortinet
G-Data
Gridinsoft
Lionic
SOCRadar
Sophos
Viettel Threat Intelligence
VIPRE
Webroot

Datos y informes externos

Instantánea de evidencia enviada
Sent: Ledger records: 1 Case ID: PD-20260922-B88C90 Recipient: abuse@godaddy.com
Page title stored with report: Your Loc Funding
URLScan evidence VirusTotal evidence URLQuery evidence Screenshot 298.3 KB
PDF notice generated Notice text archived (650 chars)
Abuse notice text as sent to the provider
Policy Violations:
Illegal Activities: Active phishing operation targeting victims
Fraud & Deception: Impersonation of legitimate services
Identity Theft: Collection of credentials under false pretenses
Applicable Laws (Unknown):
International Anti-Cybercrime Regulations
Budapest Convention on Cybercrime
Universal Fraud Prevention Laws
Phishing activities violate international cybercrime conventions and Unknown's domestic fraud laws.
Action Required: This evidence-backed report demonstrates clear violations requiring suspension per your policies. Continued hosting exposes your organization to regulatory scrutiny and potential legal liability.

¿Te ha afectado esta página web?

If credentials were compromised, report immediately. Do not engage with recovery scammers.

Si ingresó credenciales de cuenta, información personal o de pago, o descargó un archivo de este dominio, tome medidas inmediatas. A continuación encontrará recursos que le ayudarán a informar el incidente y protegerse.

Europol
Encuentre el canal de denuncia oficial para su país de la UE
National police directory
¡Cuidado con los estafadores que se hacen pasar por empresas de recuperación de datos! Los delincuentes pueden volver a contactar a las víctimas haciéndose pasar por investigadores, abogados o agentes de recuperación. No pague tarifas por adelantado ni comparta credenciales. Más información sobre el fraude en las ayudas de recuperación →

Informa a las autoridades locales

Seleccione su país para obtener contactos oficiales de cibercrimen o crear un borrador de queja →.

directorio de 97 países
Borrador asistido por IA: el proveedor de IA procesa los detalles del incidente Revíselo y envíelo usted mismo

Comprobar cualquier dominio

Análisis de amenazas utilizando listas de bloqueo almacenadas, WHOIS, DNS y evidencia de escaneo público

Escanear ahora

Denunciar un intento de phishing

Envía los dominios sospechosos a nuestra base de datos de amenazas: protege a la comunidad

Denunciar

Flujo de amenazas en tiempo real

Informes de phishing recientes y cambios de disponibilidad observados

Monitorizar

Mantente informado, mantente a salvo

Supervisa las amenazas en tiempo real o impugna esta entrada si crees que se trata de un falso positivo.

Flujo de amenazas en tiempo real Reclamar este anuncio
HTML · IFRAME

Incrustar este informe

Comparte esta información sobre amenazas en tu página web o blog

embed.html
<iframe
  src="https://phishdestroy.io/es/embed/domain/yourlocfunding.com"
  title="PhishDestroy threat report for yourlocfunding.com"
  width="100%" height="320"
  loading="lazy"
  referrerpolicy="no-referrer"
  sandbox="allow-same-origin allow-popups allow-popups-to-escape-sandbox"
  style="border:0;border-radius:12px;max-width:100%"
></iframe>