⚠️
This domain has been flagged as malicious
Detected by 10 security vendors. Exercise extreme caution — do not enter personal information or connect wallets.
smtptelstrawebmailswiferstelstrawebmailswifts.framer.website favicon

smtptelstrawebmailswiferstelstrawebmailswifts[.]framer[.]website

“Sign in with your Telstra ID”

10/95 VT URLQuery: 100 Taken Down Oct 16, 2025 Telstra
100 Threat
PhishDestroy AI
HIGH
Ref
B3A3F0D0
Score
100/100
Engine
PD-4 Turbo
PhishDestroy has identified a high-risk phishing domain impersonating Telstra to harvest user credentials. The domain, smtptelstrawebmailswiferstelstrawebmailswifts[.]framer[.]website, was designed to mimic the official Telstra login experience with the page title "Sign in with your Telstra ID," aiming to deceive users into divulging sensitive information.

Technical analysis reveals the domain was registered on 2021-11-19 via CSC Corporate Domains Inc. It has been flagged by multiple security vendors and appears on at least one security blocklist due to its malicious activity. The domain resolved to IP address 52.223.52.2, further linking it to phishing infrastructure commonly used to host counterfeit brand websites.

Currently, the domain has been taken offline, effectively disrupting the phishing operation. PhishDestroy recommends users always double-check URLs for legitimacy and avoid entering credentials on suspicious sites. Continuing monitoring and proactive takedown efforts are critical to prevent such impersonation attacks targeting trusted brands like Telstra.
VT
VirusTotal
10 det.
UQ
URLQuery
100 det.
OTX AlienVault
Clean
US
URLScan
Age
4.3 yr
Status
Down 404
PD
DestroyList
Listed
Reports
1

Threat Response Pipeline

Discovery
Submission
Legal
Takedown
20/21
Pre-emptive Discovery & Ingestion
30+ Proprietary Parsers · Infrastructure Analysis · Community Intelligence · Threat Ingested
4/4 ✓
30+ Proprietary Parsers
Distributed network scanning Google Ads (malvertising), SEO-manipulated results, Twitter/X, YouTube & Telegram campaigns
Infrastructure Analysis
dnstwist & typosquatting detection to catch look-alike domains targeting established brands
Community Intelligence
Real-time ingestion of community-reported threats via Telegram Bot & partner intelligence feeds
Threat Ingested
smtptelstrawebmailswiferstelstrawebmailswifts.framer.website detected and queued for full analysis
Oct 16, 2025
Global Ecosystem Submission
54+ Vendor Submissions · URLScan.io Snapshot · VirusTotal · Google Safe Browsing · OTX AlienVault · Brand Impersonation · Forensic Evidence Collection · Web Archive Preservation · Technical Deep Analysis · Site Went Offline
10/10 ✓
54+ Vendor Submissions
Threat data submitted to 54+ security vendors & threat intelligence platforms
Show all 54 vendors
SpamhausCloudflareGoogle Safe BrowsingMicrosoft SecurityVirusTotalNetcraftESETBitdefenderNorton Safe WebAviraPhishTankDr.WebYandex Safe BrowsingURLScan.ioPolySwarmSiteReviewURLQueryPhishStatsPhishReportIsItPhishThreatCenterKasperskyOpenPhishAPWG eCrimeComodo / XcitiumFortinet / FortiGuardPalo Alto NetworksSophosTrend MicroWebrootZeroFOXSURBLAbusixCRDF LabsQuad9CleanBrowsingCyRadarScumware.orgPhishing.DatabaseMalware PatrolANY.RUNHybrid AnalysisURLhausMalwareBazaarThreatFoxAbuse.chAbuseIPDBAlienVault OTXMISPDomainToolsSecurityTrailsCensysBinaryEdgeCIRCL
URLScan.io Snapshot
Submitted to urlscan.io — screenshot, DOM & HTTP transactions captured
Oct 16, 2025
VirusTotal
10 / 95 vendors flagged on VirusTotal
Feb 23, 2026
Google Safe Browsing
Mar 03, 2026
OTX AlienVault
Checked on AlienVault OTX — not found in threat pulses
Mar 01, 2026
Brand Impersonation
Impersonation of Telstra
Forensic Evidence Collection
Public scans via URLScan.io, URLQuery & Cloudflare Radar — DOM snapshots, HTTP transactions, DNS & certificate data
Web Archive Preservation
Site preserved in Wayback Machine — immutable copy of phishing content for legal evidence
Technical Deep Analysis
JS source analysis, directory enumeration, open directories scan, email harvesting, Telegram bot detection, exposed databases & other OSINT artifacts useful for threat actor identification
Site Went Offline
Domain stopped responding (HTTP 404) — taken down
Feb 27, 2026
Legal Notifications & Reporting
Registrar & Hosting Notification · DestroyList Published · Abuse Report Pending · Conditional Re-detection
3/4
Registrar & Hosting Notification
Initial abuse reports sent to domain registrar (CSC Corporate Domains Inc.) and hosting provider with forensic evidence packages (metadata, screenshots, PDF)
DestroyList Published
Added to PhishDestroy/DestroyList — open-source blocklist for wallets & extensions
Oct 16, 2025
Abuse Report Pending
Will be sent to registrar (CSC Corporate Domains Inc.) & hosting
Conditional Re-detection
Follow-up alerts only if threat remains active beyond 24 hours — prevents spam, ensures reports contain active evidence
ICANN Escalation — triggered only on re-detection (24h+ active threat), not on initial report. Formal complaint per RAA §3.18 with full forensic evidence
Public Transparency & Takedown
Open Threat Database · Social Broadcasting · Domain Taken Down
3/3 ✓
Open Threat Database
Real-time commits to GitHub repository & live monitoring at phishdestroy.io/live
Social Broadcasting
Automated alerts on Twitter, Telegram & Mastodon channels
Domain Taken Down
Phishing site is offline — no longer serving malicious content
Feb 27, 2026

Public Blocklist Status

Evidence Capture

Snapshot
2025-10-16 14:57 UTC
Malicious
Forensic screenshot of smtptelstrawebmailswiferstelstrawebmailswifts.framer.website
IP: 52.223.52.2
CSC Corporate Domains Inc.
1,564d

Domain Intelligence

Domainsmtptelstrawebmailswiferstelstrawebmailswifts.framer.website
IP Address52.223.52.2
CreatedNov 19, 2021
ExpiresNov 19, 2026
Nameserversns-1243.awsdns-27.org
ns-1818.awsdns-35.co.uk
ns-336.awsdns-42.com
ns-792.awsdns-35.net
Page TitleSign in with your Telstra ID
Abuse Contactsdomainabuse@cscglobal.com
First DetectedOct 16, 2025
HTTP Status404
Report This Domain Submit evidence & help protect others

VirusTotal Analysis

10 / 95 security vendors flagged this domain
View on VT
ADMINUSLabs
Criminal IP
alphaMountain.ai
CyRadar
ESET
Forcepoint ThreatSeeker
Fortinet
Kaspersky
Sophos
Webroot

Evidence & External Reports

Were You Affected by This Site?

You are not alone and there is nothing to be ashamed of. Scammers are sophisticated criminals who exploit trust. Reporting your experience is the most powerful weapon against fraud — your report can prevent others from becoming victims and help law enforcement take action. Silence is the scammer's greatest advantage. Break it.

If you have interacted with this domain, entered personal information, or connected a cryptocurrency wallet — take immediate action. Below are resources to help you report the incident and protect yourself.

Beware of recovery scammers! After being scammed, criminals may contact you again pretending to be "recovery agents," lawyers, or investigators who claim they can retrieve your lost funds — for a fee. This is a second scam. No legitimate service will ask for upfront payment to recover stolen crypto. Learn more about recovery fraud →

Report to Your Local Authorities

Select your country to get official cybercrime contacts, ready-to-use complaint templates, and step-by-step filing instructions.

Select your country...
180+ countries

Related Domain Reports

dsjhfjdjh-hkdfjg-4a4589.netlify.app
dsjhfjdjh-hkdfjg-4a4589.netlify.app
21 detections · Similar title
tpbpcommunitels234.framer.website
tpbpcommunitels234.framer.website
21 detections · Similar title
fearless-calendar-501570.framer.app
fearless-calendar-501570.framer.app
20 detections · Similar title
saintdashboard.com
saintdashboard.com
20 detections · Similar title
dexrp.website
dexrp.website
3 detections
kecoa4.mr-aleex.website
kecoa4.mr-aleex.website
1 detections
play-sweet-bonanza-drk.website
play-sweet-bonanza-drk.website
19 detections
dr3z.closer.website
dr3z.closer.website
18 detections

Other Domains on 52.223.52.2

sharp-aim-536555.framer.app sharp-aim-536555.framer.app 26 formal-instance-163555.framer.app formal-instance-163555.framer.app 23 magnificent-reflect-934880.framer.app magnificent-reflect-934880.framer.app 23 coinbase-learn.framer.media coinbase-learn.framer.media 22 startedtrzerr-io-us.framer.ai startedtrzerr-io-us.framer.ai 22 original-conference-726613.framer.app original-conference-726613.framer.app 22

More Domains at CSC Corporate Domains Inc.

coinbase-sigin.framer.website coinbase-sigin.framer.website 10 coimbase-pro.framer.website coimbase-pro.framer.website 6 swiftsubreviewwebmail.framer.website swiftsubreviewwebmail.framer.website 12 upholldlog.framer.website upholldlog.framer.website 14 telstraaccountrecovoreysystem.framer.website telstraaccountrecovoreysystem.framer.website 15 learn-metamsks.framer.website learn-metamsks.framer.website 7

Other Telstra Impersonation Domains

These domains also target Telstra users. View all Telstra threats →

dsjhfjdjh-hkdfjg-4a4589.netlify.app dsjhfjdjh-hkdfjg-4a4589.netlify.app 21 tpbpcommunitels234.framer.website tpbpcommunitels234.framer.website 21 fearless-calendar-501570.framer.app fearless-calendar-501570.framer.app 20 fanciful-mochi-5f3a5e.netlify.app fanciful-mochi-5f3a5e.netlify.app 19 grounded-course-230298.framer.app grounded-course-230298.framer.app 19 myid-telstra.flutterflow.app myid-telstra.flutterflow.app 19 earlier-concept-180784.framer.app earlier-concept-180784.framer.app 18 fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com 18

About This Report: smtptelstrawebmailswiferstelstrawebmailswifts.framer.website

This domain security report for smtptelstrawebmailswiferstelstrawebmailswifts.framer.website is maintained by PhishDestroy's automated threat intelligence pipeline. Our system continuously monitors this domain across 95 security vendors on VirusTotal, URLScan.io.

The site displays a page titled “Sign in with your Telstra ID”, which may be designed to impersonate Telstra.

smtptelstrawebmailswiferstelstrawebmailswifts.framer.website has been flagged by 10 security vendors as of March 3, 2026.

If you believe this listing is inaccurate, you can submit an appeal. For more information about our methodology, visit our FAQ page.

Stay Informed, Stay Safe

Monitor live threats or contest this listing if you believe it's a false positive

Live Threat Feed Appeal This Listing

Recommendations & Advice for Victims

An estimated $51 billion flowed to illicit crypto wallets in 2024 (source). If you interacted with smtptelstrawebmailswiferstelstrawebmailswifts.framer.website — act now.

What should I do immediately?
Urgent
  • Revoke token approvals — use revoke.cash to remove access granted to malicious smart contracts
  • Move remaining funds to a brand-new wallet. The compromised wallet is no longer safe
  • Change all passwords — email, exchange accounts, anything that shares the same password
  • Enable 2FA using an authenticator app (not SMS). Disable SMS-based recovery
  • Freeze cards if you entered banking details on the phishing site
What information should I collect for my report?
FBI guidelines

According to the FBI, the most important details are transaction data:

  • Cryptocurrency addresses — scammer's wallet (e.g., 0x5856...35985)
  • Amount & crypto type — exact amount (e.g., 1.02345 ETH, 0.5 BTC, 500 USDT)
  • Transaction ID (hash) — the unique blockchain transaction identifier
  • Exact dates & times — of each transaction and first contact with scammer
  • Screenshots — scam website, chat messages, emails, wallet transactions, social media
  • All URLs & domains used by the scammer (including smtptelstrawebmailswiferstelstrawebmailswifts.framer.website)
  • Communications — emails, texts, phone numbers, usernames the scammer used

Even if you don't have all details — file a report anyway. Partial information still helps investigations.

Where should I report the scam?
  • FBI IC3 — Internet Crime Complaint Center (US federal reporting)
  • Europol — European cybercrime reporting (EU)
  • Chainabuse — flag scam wallets across exchanges & platforms
  • Your crypto exchange — contact Coinbase/Binance/Kraken support to freeze scammer's address
  • Local police — creates an official record, even if they can't act immediately

The FBI recovered over $1 billion in crypto fraud in 2024 thanks to victim reports. Your report matters.

How do crypto scams typically work?
  • Fake websites — pixel-perfect clones of legitimate sites with slightly altered domains
  • Malicious approvals — "connect wallet" prompts that grant unlimited token spending to attackers
  • Pig butchering — trust built over weeks via Telegram/WhatsApp/dating apps, then money stolen
  • Recovery scams — victims targeted AGAIN by fake "recovery agents" demanding upfront fees. Always a scam
  • Fake ads & airdrops — Google/social media ads and "free token" offers leading to wallet drainers
  • AI-powered scams — deepfakes, automated phishing, and AI-generated sites making fraud harder to detect
How can I protect myself in the future?
  • Use a hardware wallet (Ledger, Trezor). Never store large amounts in browser wallets
  • Bookmark official sites — never click links from emails, DMs, or ads
  • Read every approval — verify permissions before signing. Reject unlimited approvals
  • Verify domains — check on PhishDestroy before interacting. Check HTTPS, spelling, domain age
  • "Too good to be true" = scam — guaranteed returns, celebrity endorsements, urgent deadlines
How big is the crypto scam problem?
  • $51 billion flowed to illicit crypto wallets in 2024 — CoinLedger
  • Pig butchering losses grew 40% year over year, now the fastest-growing fraud type
  • Only ~5% of victims report — your report helps shut down criminal networks
  • FBI recovered $1B+ in 2024 thanks to victim reports — FBI.gov

Sources: FBI · CoinLedger · WorldMetrics