# PhishDestroy domain threat record: ivvvaaannaaalaaawiiiiifamilly.blogspot.com Content language: English Canonical HTML report: https://phishdestroy.io/domain/ivvvaaannaaalaaawiiiiifamilly.blogspot.com/ Machine-readable companion: https://phishdestroy.io/domain/ivvvaaannaaalaaawiiiiifamilly.blogspot.com/llm.txt ## Summary PhishDestroy stores a threat-intelligence record for this domain. This document reports the latest stored fields; it is not a real-time guarantee of availability or safety. ## Stored observations - Listed by PhishDestroy: yes - Availability at last stored check: observed active - First observed by PhishDestroy: 2026-07-30 11:54:03 UTC - Last availability or vendor check: 2026-08-20 10:01:24 UTC - Stored record updated: 2026-08-20 18:20:26 UTC - VirusTotal detections in the stored snapshot: 16/91 - Independent public blocklist matches in the stored snapshot: 0 - Google Safe Browsing stored result: no stored flag ## Stored classification - Targeted brand: Facebook ## Stored infrastructure - Observed IP address: 192.178.183.132 - Registrar in stored WHOIS data: Google LLC ## Evidence links - URLScan report: https://urlscan.io/result/019fb2f0-798c-7413-ae24-98bfe4dfd43e/ - VirusTotal domain view: https://www.virustotal.com/gui/domain/ivvvaaannaaalaaawiiiiifamilly.blogspot.com - Certificate Transparency search: https://crt.sh/?q=%25.ivvvaaannaaalaaawiiiiifamilly.blogspot.com - Web Archive lookup: https://web.archive.org/web/*/https://ivvvaaannaaalaaawiiiiifamilly.blogspot.com/ ## Corrections - Appeal or correct this record: https://phishdestroy.io/appeals/ - Methodology and help: https://phishdestroy.io/faq