# PhishDestroy domain threat record: fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com Content language: English Canonical HTML report: https://phishdestroy.io/domain/fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com/ Machine-readable companion: https://phishdestroy.io/domain/fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com/llm.txt ## Summary PhishDestroy stores a threat-intelligence record for this domain. This document reports the latest stored fields; it is not a real-time guarantee of availability or safety. ## Stored observations - Listed by PhishDestroy: yes - Availability at last stored check: not observed active - First observed by PhishDestroy: 2026-01-25 14:34:31 UTC - Last availability or vendor check: 2026-08-21 01:14:50 UTC - Stored record updated: 2026-08-21 18:21:54 UTC - VirusTotal detections in the stored snapshot: 18/93 - Independent public blocklist matches in the stored snapshot: 0 - Google Safe Browsing stored result: no stored flag ## Stored classification - Targeted brand: Telstra ## Stored infrastructure - Observed IP address: 74.115.51.9 - Registrar in stored WHOIS data: Squarespace Domains II LLC - Registrar country in stored WHOIS data: US - Registration date in stored WHOIS data: 2026-02-21 06:01:08 UTC ## Evidence links - URLScan report: https://urlscan.io/result/019bf524-5696-77ac-9bca-42b0531883e3/ - VirusTotal domain view: https://www.virustotal.com/gui/domain/fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com - Certificate Transparency search: https://crt.sh/?q=%25.fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com - Web Archive lookup: https://web.archive.org/web/*/https://fhhhggrhrhrseriiivcevsercvicmsyp.weebly.com/ ## Corrections - Appeal or correct this record: https://phishdestroy.io/appeals/ - Methodology and help: https://phishdestroy.io/faq